SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007478294.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007478294.1.35504
Domain Number 1 Region: 110-332
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.36e-61
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000209
Family Fibronectin type III 0.00000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007478294.1.35504
Sequence length 346
Comment PREDICTED: fibronectin type 3 and ankyrin repeat domains protein 1 isoform X3 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MDSQTIVPASKPHPPVVGKVTHHSIELYWDLDKKIQRKGPQEQWLRFSIEEEDPKMHTYG
IIYTGYATKHTVEGLEPRTLYKFRLKVTNPSGEYYYSPVVSVSTTREPISSEHFHRAVNV
NDEDLLVRILQGGHVKVDVPNKFGFTALMVAAQKGYIRLVKILIGNGTDVNMKNGSGKDS
LMLACYAGHLDVVKYLRAHGASWDARDLGGCTALHWAADGGHSNIIEWMIKDGCQIDVLD
TGSGWTPLMRVSAISGNKEVASLLIEAGADVNMKDKDGKTPLMVAVLNNHEELVQLLLEK
GADPSVKNEFGKGVLEMARVFDRQNVIALLEDQKGILSLKKTSYLS
Download sequence
Identical sequences F7DR54
ENSMODP00000013176 ENSMODP00000013176 XP_007478294.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]