SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007479716.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007479716.1.35504
Domain Number 1 Region: 492-548
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000536
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000122
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 552-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 373-429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 433-486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 6 Region: 262-312
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000275
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007479716.1.35504
Sequence length 654
Comment PREDICTED: thrombospondin type-1 domain-containing protein 4 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MFVSYLILTLFYVQTAVLARPEGETIGCDDYLGSDRVVDKCGICGGDNTGCQIVSGVFKH
TLTSLGYHRVVEIPQGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGT
MFTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVISGTNAISPQLPPH
RRPGEPFNGQLAVPDGRNPEEEEKQEEKKFPSGEMEIFTEDKVHSFPVRQPERFSPHQPD
NLVPVLQSPRRTRDHNWKQVGTTECSATCGKGTLYHINHCERRNTHEEAPESYCDPSTKP
TPEEEACNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQMYANRTLTVQPYRCQHLEK
PETTSTCQLKICSEWQIRTEWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPND
IENCDMGACAKSWFLTEWSERCSAECGVGVRTRSVVCMTNHVSSLPLEGCGNNRPAEITP
CDNGPCAGKVEWFAGSWSQCSIECGRGTQQREVICIRKNPDTFDVLDPHECSFSERPPSQ
QSCYLKPCGAKWFSTEWSVCSKSCQGGFRVREVRCLSDDMTPSNHCDPQYKPEEKESCNT
QDCVPEVDENCKDKYYNCNVVVQARLCVYTYYKTACCASCTRVANRQSTFSGRR
Download sequence
Identical sequences F7GL34
ENSMODP00000011131 XP_007479716.1.35504 ENSMODP00000011131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]