SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007481375.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007481375.1.35504
Domain Number 1 Region: 159-231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-18
Family Complement control module/SCR domain 0.00048
Further Details:      
 
Domain Number 2 Region: 282-344
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000197
Family Complement control module/SCR domain 0.00071
Further Details:      
 
Domain Number 3 Region: 222-292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000553
Family Complement control module/SCR domain 0.00045
Further Details:      
 
Domain Number 4 Region: 95-169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000076
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 31-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000256
Family Complement control module/SCR domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007481375.1.35504
Sequence length 445
Comment PREDICTED: membrane cofactor protein-like isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGACPLREAWLPSVGLLWALALLGLPRASGNCSTPPTIPYAHPEESYDADKTFGDGTTIT
YKCDTGYAKIPGKSNSVTCQGVEWSEIPQFCNRSCNQPPRYNTMQPDSAFISQNYFPINS
TVTFVCRPGHSLIKLGPLLSICQDDGSWSPISESCKKKSCPTPVTPDHGQIMTPTDILFG
SKIEYSCDEGYHLIGDAVRHCTLSNNQVLWSGESPVCEITTCLSPPNINNGKHNGGHKDV
FTYGETVTYHCDLRAQDQFSLIGEATITCAEHGEWNKPTPECKVVKCTTPYVPNAVQVSG
FGSSHTYKDTIVFECKEGYILQNNRKITCEADNKWKPELPICSEASGLPSSQAPPATSRP
GTTIASQTKPPVSRQPGPSLPPVEEPPSGQMSPGIIALIAIAAIVFVIIILVISHQYNKK
KGTYITDEIHKEDTVLNSLKPHEEA
Download sequence
Identical sequences K7E5T1
ENSMODP00000041133 XP_007481375.1.35504 ENSMODP00000041133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]