SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007481451.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007481451.1.35504
Domain Number 1 Region: 892-1185
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.42e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00001
Further Details:      
 
Domain Number 2 Region: 213-355
Classification Level Classification E-value
Superfamily PH domain-like 4e-31
Family Third domain of FERM 0.0084
Further Details:      
 
Domain Number 3 Region: 104-212
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-27
Family Second domain of FERM 0.00044
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-20
Family First domain of FERM 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007481451.1.35504
Sequence length 1189
Comment PREDICTED: tyrosine-protein phosphatase non-receptor type 14 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKQLDKFANEPLLFFGVMFYVPNVSQLQQEATRYQYYL
QVKKDVLDGRLRSTLEQGIRLAGLAVQADFGDYNQFESQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQESFPVKDNHGNNVHLGIFFMGIF
VRNRIGRQLIHRWNDIGNITHNKSTILLELINKEETALFHTDDIENAKYISRLFATRHKF
YKQNKICTEQSSSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYTETHTSQDSIFHG
NEDAFYYRSQTSLDRCAMDINYLNGTVTNGSVCSAHSVNSLNCSQNFMQASPVSSNLSIP
GSDIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVMHVDSQSQSLRNLNIGNTHA
YNRPEELVYSQPEIRERHPYTVPYVPHGGYSKPVGRADPIKPNNKSVHGKKAPSAISHTV
STPELANMQLQSSHSYNTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHRYVSGSSPDL
VTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTANKRHAPVNKRHSLEVISNMVRGIEAMA
LKTLNAPIPRRNTLREQVQPEEAQRSHDVQQLPHFHHKKTSSDATMLIHSSESEEEEETP
EVVPRIPALRDDVRYNAQLQAALARIPNKPPPEYPGPRKSISNGALRQDQGNVCAAVART
RVMRPGPAKAMSVSRPDQLTINGSSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLED
SIIEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVPGREVSQDDASRMTMDDRFR
TLKKKLEEGLVFTEYEQIPKKKPDGVFTTAILPENAERSRIREVVPYEENRVGLVPTKEN
STGYINASHIKVAVAGEEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEESGRTK
SHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWP
DHGCPEDVQGFLSYLEEIQSVRRHTNSMLDNTKNCNPPIVVHCSAGVGRTGVVILTELMI
CCLEHNEKVDVPMMLRHLREQRMFMIQTITQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences F6SJ89
ENSMODP00000003992 ENSMODP00000003992 XP_007481447.1.35504 XP_007481449.1.35504 XP_007481450.1.35504 XP_007481451.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]