SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007487071.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007487071.1.35504
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-60
Family DBL homology domain (DH-domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-33
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-29
Family DEP domain 0.0029
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.12e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000434
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 581-673
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000565
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007487071.1.35504
Sequence length 1606
Comment PREDICTED: phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTEESKGEGKGESGKDLEKQLRLRVCVLSELLKTERDYVGTLEFLVSAFLHRMIQCAASK
VDKNVTEETVKMLFSNIEDILSVHKEFLTVVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPRKHSDYAVLMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMYGVLLKISAGNIQERVFFLFDNLLVYCKRKHRRLKNSKTSIDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHIVINGWKIHNTAKNKWFVCMAKTPEEKHEWLEAIMKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCQQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHKPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSKKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHVTACRKYRRPMKQDSIQWVYNSIESAQEDLQKTNSKPPGDDG
GDAFDCKVEEVIDKFNTMAIIDGKKDHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI
EPKGFFSLTAKILEALAKSDEHFVQNCTSLNTLNEVIPTDLQSKFGTICSDKIEHICRRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGV
QLDNRKHNSHDKENKVSEQGKLNPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDL
ETQDIYQKLLGKLQTALKEVEICVCQIDDLLSSITYSPKLEHKTSESLIPTDSDNEKGER
NGKKVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSIRISHDKQDKLHGCLEHLFSQVDSITNLLKGPAVVRVFEQTKYFTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVRNLAQNIRRFVEEVKSRILLALLEYTDSEIQ
LRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVSFYFRPAEQDPLVANMPLTYQAEGSRQALRVY
FYIDSYHFDQLPQRLKNGGGFKVHPVLFAQALESMEGYYYRDSVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDKSNSPPNSTSKAAYIDKLMRPLNALDELYRLVISFIRSKRTAACAY
TACSASGVGLLSVSSELCNRLGACHIIMCNSGVHRCTLSVTLEQAIILARSHGLPPRYIM
QATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCQPPPPAGEE
Download sequence
Identical sequences F7CPA6
XP_007487071.1.35504 ENSMODP00000009427 13616.ENSMODP00000009427 ENSMODP00000009427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]