SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007488469.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007488469.1.35504
Domain Number 1 Region: 398-454
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000484
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 454-509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000484
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 509-564
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 346-395
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000379
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 257-308
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000916
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  XP_007488469.1.35504
Domain Number - Region: 936-1108
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00174
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007488469.1.35504
Sequence length 1617
Comment PREDICTED: brain-specific angiogenesis inhibitor 1 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MRSSAAALELVWSLTPLLLVLVQPSWAVGGTDSGQGSDPCATLVLGKFFGYFSSASVFPA
NASRCSWTLRNPDPRRYTLYMKVSKPAGPCGPWPVRTYQFDSFLESTRTYLGVESFDEVL
RLCDPSARYAFLQSNKQFLQMRRQQQLGPDDQALVSPYPGPDAEFSVEYLVVGNRSASRA
ACQMLCRWLEACLAGSRSSHPCGIMQTPCACSGGDAPDLAAGESPSRGDDCLRDGTESPE
NCLTSLTKDRGGDGRTGGWNLWSLWGDCTRDCGGGLQTRKRTCLALPGHGAACEGVLEEG
RLCNRKACNTSGRYNSRSQSLRSTDTRRREEADDLQQFGYPSPQTGDPAAEEWSPWSVCS
TTCGEGWQTRTRFCVSSSYSTQCSGPLREQRQCNNSAICPVHGTWDEWSPWSLCSSTCGR
GFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPVDGNWNEWSSWSSCSSSCSNGTQQR
TRECNGPSYGGAECQGHWAETRDCFLRQCPVDGKWQAWGTWGSCSTTCGGGTQRRDRACH
GPFFGGEACQGPKEEYRQCSQRRCPEPHEICYEDNAGSMVWKETPAGDVAAIRCPRNATG
LILRKCVLDEEGVANWEPPTYIKCVSIDYRNIQMMTREHLVKAQRGILVEDVSEVIQTLV
EISQDGTSYSGDLLSTIDMLRNMTEIFRRAYHSPTPGDVQNFVQIISNLLTEENRDKWEE
AQLMGPNAKELFRLVEDFVDVIGFRMKDFRDSYQVTDNLVLSIHKFPASGATDISFPMKG
WRTPGDWSRTSEDKVTVSKSVFSTGLAETDASSVFVIGTVLYRNLGSILALHRNTTVLNS
KVISVTVKPAPRSLQTPLEIEFSHMYNGTTNQTCILWEEADVSSSSSSSQLGPWSWRGCR
TVPLDAFRTRCLCDRLSTFAILAQLSADGNMEKVIVPSVTLIVGCGVSSLTLLLLIIIYV
SVWRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVICTLVAAFLHFFFLSSFCWVL
TEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAISVGFTKAKGYSTVNYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGQMAVPLYGLALKCAKCG
VVSAAQETAATTSNAMASLWSSCVVLPLLALTWMSAVLAVTDRRSALFQILFAVFDSLEG
FVIVMVHCILRREVQDAVKCRVVDRQEEGNGDSGGSFQNGHAQLMTDFEKDVDMACRSGE
HLTVLNKDITACRTSTITGTLKRPSIQDEEKLKLNHPKTPSNFNSLPTNVSKMHLQGSPH
YLGGVNLSEFANHTLTLKKDKTPKSIYICDGDIFKKLDSELSRAQEKVLDTSYVILPTNT
ATLRAKPPKDEGKYSINIDHMPQTRLIHLNMAADPSYGVKSPPREPASGPEAQASSLTPA
QPPAPPSAPPPPQQQPLPPPPAPHSLAPEPHPSTLGEPSTEGAPTGVVNKSETVSTLSMS
SLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKLQHAEKEKEKEAPVAESKPEKQQTPN
RRPWDSVRKGQTTPAWVKKEIDLLPPSPLELKTVEWEKTGATIPLVGQDIIDLQTEV
Download sequence
Identical sequences F6TRV4
ENSMODP00000000700 XP_007488469.1.35504 ENSMODP00000000700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]