SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007489100.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007489100.1.35504
Domain Number 1 Region: 9-121
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-18
Family SH2 domain 0.00081
Further Details:      
 
Domain Number 2 Region: 354-520
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-16
Family Ras GEF 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007489100.1.35504
Sequence length 648
Comment PREDICTED: SH2 domain-containing protein 3A [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MEKVGESLDPDKELVDQTWYHGRLSQKEAEALLLKDGDFLVWASPSTLVLDSSPLVLSCC
WGGQPLHFDVVRIQLRPRPGRPSRALFQLEDERFPSLPALVKCYVATQRPLSQASGAVAS
RPVARHGPPRPTTFGKPRHRRSLSGDGCSDGTRQVHKGLLRTKELSGSQPSLDTLRHRGG
PPKGSKGPGSPDDPHMAKMVPPASPLFRTGSDPVLRRAQELSIGTPQWGSDGQLHPKGPL
KPPRAPSVLLPECPGTPTSCELLPQEILHFQRKGGDDGKPGTREAARHGPRDRQETEHKT
EAWPGEETMPREGQNGQLSNKEGPQEAPWWEEWEQEEAEDFVRPQGGATPALQPQAFSSC
LLGPENRPLEPSALRTLRALFLQHDVGTVAQHLLLTDCQAAQVLGVTRTQRQAMGVHSGL
ELLTLPHGHQLRLNLLERHEALALAAATAVVGCSGPVAERVATLLGLIQLALALRAPGGA
DLFALSSVMTALQLPQITRLERTWRLLRQNHTEAALAFEKELKPFVRALDEGAEIGLPGE
VAVPHIMPVTQLLEGAQLWGSHEESCERLLRTLQGARTMASHASHYREAARARLKGFQPT
PELCEAFQTEFALRLLWGSRGAGATQAERHKKFHLILNALSWRLEPES
Download sequence
Identical sequences F6ZEF4
XP_007489100.1.35504 ENSMODP00000032532 ENSMODP00000032532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]