SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007491732.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007491732.1.35504
Domain Number 1 Region: 221-335
Classification Level Classification E-value
Superfamily Acid proteases 7.13e-28
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.65e-17
Family Ubiquitin-related 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007491732.1.35504
Sequence length 398
Comment PREDICTED: protein DDI1 homolog 2 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRS
LASYGLKDGDVVILRQKENAEPRPSVQFPSLPRIDFSSIAVPGTSGSRPHQQPAQPPRTS
PADTASSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFTKVLIEQQQD
RARREQERIRLFAADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAPESFGQVVMLYINCK
VNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRVHLAQVQI
EGDFLPCSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTGTQTTFLPEGELPEC
ARLAYGSGRDDIRPEEIADQELAEALQKSVEDAERQKP
Download sequence
Identical sequences F7C7X8
13616.ENSMODP00000004298 ENSMODP00000004298 ENSMODP00000004298 XP_007491732.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]