SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007493867.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007493867.1.35504
Domain Number 1 Region: 1476-1761
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-82
Family Protein kinases, catalytic subunit 0.00000012
Further Details:      
 
Domain Number 2 Region: 641-733
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-25
Family I set domains 0.004
Further Details:      
 
Domain Number 3 Region: 1347-1462
Classification Level Classification E-value
Superfamily Fibronectin type III 5.02e-25
Family Fibronectin type III 0.00063
Further Details:      
 
Domain Number 4 Region: 1839-1931
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-24
Family I set domains 0.0000101
Further Details:      
 
Domain Number 5 Region: 174-266
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-24
Family I set domains 0.0041
Further Details:      
 
Domain Number 6 Region: 532-622
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 7 Region: 1134-1228
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 1268-1365
Classification Level Classification E-value
Superfamily Immunoglobulin 7.67e-22
Family I set domains 0.00000952
Further Details:      
 
Domain Number 9 Region: 45-139
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-21
Family I set domains 0.0042
Further Details:      
 
Domain Number 10 Region: 432-525
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 11 Region: 739-833
Classification Level Classification E-value
Superfamily Immunoglobulin 3.47e-20
Family I set domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007493867.1.35504
Sequence length 1948
Comment PREDICTED: myosin light chain kinase, smooth muscle isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MYTGLHEKRLEQAKTMGDVKLVASAHISKGALNSRPSGLSSSALNEAPTFILPPRNLCVP
EGGTARFEGKVRGHPEPQVTWHKNGKRITQGGRFLLSCNIRGQFSLDIQSVKGVDGGKYI
CEASNSSGVQQITVELNVEGNSLKMNREPSGAKALGGRLAAPTDNLPSIWGESPPRFATK
LSRVVAREGQTGRFSCKITGRPQPQVTWLKGDVPLEPNAHIHMLEKNGMQVLEIQEVQLS
DVGVYTCVAVNVAGKASMSSELIIQGTDNTKRSLMNAVVIESSEAKMVTTSKISKSPQPN
CLENVTKSQNHPNFPKTSYRENERAHSSPQPMSDSHPEPLYKLHEKAPEVAPVLQKTSST
IILQPVRTPLETKPQTTGNLPLQGKETMPTAQPTASSLTKKPDSKSQNLQTKIATKKITL
ENRRNKTLDKSPQFLIQPKSQEIQEGDEVKFKSQVSGTPKPTVEWFRDSTFLMEREGIQI
YEEEDGTHCLCLPKAQMEDSGSYSCMAYNIKGRVTSRWMLTVRRPRVSKMPPSFSSVLKD
CTVIEGEDFVLQCTIEGKPTPYVTWLLNDRSIQYAHTTFEDGVAELQVQDALPEDNGLYT
CLAENSSGQASCSARVTVQEKKSSKEIDCSPSVVPSDSSPPIFLKGLSDLEVMDGSQVIM
TVQLSGNPPPEILWLHNGKEIQESEDFHFEQNGSEYSLCIQEVFPEDTGRYTCEAWNSTG
QVQSHAMLTVQEPQDGTQPWFISKPRSVTATPGQNVLISCAIAGDPFPTVQWLRNGRVLT
KDAGYSEVLQNEDVFTMVLKNVQFSHAGQYEIQLRNRVGACSCQVALMLRESPSGALGEA
IPLCLGKEPASCEGLAGGGGGGGSGVGSGGSGGGHHGTLRPLGLGNRLSWRPEEEGEDVR
GVLKRRVETREHTEDRLRQQEVEQLDFRDLLGKKVCTKTLSEEELKEIPAEQMDFRANLQ
RQVKPKTLSEEERKVHSPQQVDFRSVLAKKGGPKAPVLEKTPLPKPATPDFRSVLGNKKK
LPAENGSANAESLNAKAGENAKLVENTRLIGNAKLAETQKPFGGAKLADTQKSIGNATPA
ETKKPIGNTQPAEPPKQAGKEELKNEVINDVNCKRACTGALDSDKTAEKKGTPPGFTEKL
QDLRVAEGSKLILQCQVVAEPPAAITWTLNGKTLKSTKFIALAQEGSLCSVTIEKAMPED
NGTYKCLAKNAAGQAESSCHVTVDEAPSGQMKSRRSKSSIPPVLGTESDATVKKKPAPKT
PPKAALPPQIIQFPEDKKVRAGESVELFCKVAGTQPITCSWMKFRKQIQESEHIKIETSE
NSSKLTILSTRQEHCGCYTLLAENKLGTKQAQVNVTVVDKPDPPAGTPCASDIRSSSLTL
SWYGSSYDGGSAVLSYSVEIWDSVDKEWKELTTCRSTSFSVQNLLPDREYKFRVRAINVY
GTSEPSQESELTTVGEKPEEPKDEVELSDDDEKEPEVDYRTVAINTEQKVADFYDIEERL
GSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKDKENIRQEIDIMNCLHHPKLVQCVDAFEE
KANIVMVLEIVSGGELFERIIDEDFELTERECIKYMKQISEGVEYIHKQGIVHLDLKPEN
IMCVNKTGTRIKLIDFGLARKLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVI
CYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDC
TQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGR
KSSTGSPTSPLNADKLETEEDVSQAFLEAVAEEKPHVKPYFTKTILDIEVVEGSAARFDC
KIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIADVCGDDDAKYTCKAVNSLGE
ATCTAELIVETMGKEGEGEGEGEEEEEE
Download sequence
Identical sequences F6PR65
XP_007493867.1.35504 ENSMODP00000022873 ENSMODP00000022873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]