SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007496078.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007496078.1.35504
Domain Number 1 Region: 33-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-24
Family La domain 0.00077
Further Details:      
 
Domain Number 2 Region: 118-188
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.96e-20
Family Canonical RBD 0.003
Further Details:      
 
Domain Number 3 Region: 457-561
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000245
Family Canonical RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007496078.1.35504
Sequence length 590
Comment PREDICTED: la-related protein 7 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
METENGNQDKSMEEESTEQKKEGEKKKRSRVKQVLSDIAKQVDFWFGDANLHKDRFLREQ
IEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALKSSSVVELDLEGTRVRRRQPLGEKPK
DVDDRTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAD
KAIEFLNNPPEEAPRKPGMFPKTVKNKPIPTLNTNICRVSEEKKKKKKKKSRIKKEGVQT
AVEPKETNTDATDEHLEHVNKLKRHRTSEGSEVSSSDTQRPPCKKEKKKKERSEVLSLPE
EARGKRKRMNSGDVETLMPRSKVKKSSLKEESTKEEQSKAEIPKDCKDLEVSTEEEKDAG
DMKDGSLLKSKRKHKKKHKERHKMGEEVIPLRVLSKSEWMELKKEYLALQKASMASLKKT
ISQIKSENSRQMDTDPGIKNGHANSEDCQPPEKVNTMGPQFVSGVIVKIISTDPLPSRKH
LRETLAVIAEVVYVDVLEGDTECHARFKTPEDAQAVIKAHAEIKKKYNWKFEILSGDHEQ
RYWQKILVDRQAKLNQPREKKRGTEKLINKAEKIRLAKTQQASQHIRFSE
Download sequence
Identical sequences F6VKQ2
XP_007496077.1.35504 XP_007496078.1.35504 ENSMODP00000007024 ENSMODP00000007024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]