SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007498861.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007498861.1.35504
Domain Number 1 Region: 6-212
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.64e-45
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 200-331
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000268
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007498861.1.35504
Sequence length 333
Comment PREDICTED: rho guanine nucleotide exchange factor 39 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGSPGPRCPVSEQRARWERKRGRTARELLETERRYQEQLALVVQYFLCILRAKGTLRPAE
LLAVFGPWESIHIASQELLLHLEAGNWGAGLERFCHHLELYTRFAANEEQSRATLQKRLR
KSKHFRRFVQLQEGRPEFGGLRLVDLLPLPLQRLQQYENLVVALAENTGPDSPDYPQLTK
AAQKLSEAIQHVSAISREQENGRQLHRIQTLLSGRRAKGLTKGRWFLRQGWLLVVPPKGE
PKPRMFFLFSDALLMAKPRSVLHVLYGGTFACRALYPMAQCQLQRIFGHSGGAGGGLLSL
SFPQEKLLLMSTNQESLSRWYHSLTLAISSQRR
Download sequence
Identical sequences F6YX78
ENSMODP00000009309 XP_007498861.1.35504 ENSMODP00000009309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]