SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007499033.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007499033.1.35504
Domain Number 1 Region: 654-816
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.41e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0014
Further Details:      
 
Domain Number 2 Region: 794-911
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.06e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0099
Further Details:      
 
Domain Number 3 Region: 79-185
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-21
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Weak hits

Sequence:  XP_007499033.1.35504
Domain Number - Region: 417-467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0193
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007499033.1.35504
Sequence length 965
Comment PREDICTED: TBC1 domain family member 2A isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MKPGSPGGPWLPLAPGAETAPPSTLTLEMETPRESGWPAPDEAPLEPVSGNDPCPVSEKG
AATPEDPEAALYKSGKEVMGENTKLCGYLLKFGGKGPIKGWKSRWFFYDERKCHLYYSRT
AQDVNPLGSIDLSCVTFDCKVEAEEGTFEIKTPSRVITLKAVNKQTMMYWLQQLQLKRWK
FYNSQPGILVSGVTNETSPGNASPLHITLDLDNTETDEFFCPVKTPTGLVGIAAASQPIP
EMPSTLQNISLKHLGTEIQNTMHIICSNRQSRGNGHVSQGDESQKFEENQNEEQHLQADP
GLTGKETEEYSRSTQKSGLTANFIQKAKKQNSSFPIFAEGLREKSFQDKVGVLEQQVMML
SEELKSQKELVKILHKALEAAQQEKRTCSTYLTATEDKDRLELVRHKVRQIAELGKRVES
LQQDKKALEQTLGLREEHIKELEQHVQLLMDKNHAKQQVIFKLTEKVTKDFIDPPTSADG
LESGTFLNPYEKIEHLKDDIEAYRTQNRFLNSEIHQVTKIWRNAAEKEKVLLMKCAYLQA
KNCQIESKYLTVLRKLQDTLPIDDSEYGEMLKKLIHEALQWDVKEGATDSMKFNPVSEYD
DYGFMTVPDYEVEDLKLLAKIQALEIRSNNLLNHEAVEKPLREKWNSIGELMPSADLKHL
IRSGIPPEHRQRVWKWMISLRVKPIQAPNHYDSLLRKCETMEHPAFRQIELDLNRTLTNN
KHFTNPTSKFISKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLILEEEESAFWCLVCIVE
TIMPADYYSKTLIASQVDQRVLQDFLSEKLPRLMAHLGQHKIDLSLITFNWFLVIFVDNL
ISDILLRVWDAFLYEGIKVIFRYALAIFKYNEEAILRIHDSLEIYQYLRFFTKTICNGRK
LMNIAFNDMNPFPMKQLRNRRAVHREKLETELGELEHIKAEFLKERARQESKLLEGCMSE
DEEET
Download sequence
Identical sequences F6PZI4
ENSMODP00000015682 ENSMODP00000015682 XP_007499033.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]