SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007499163.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007499163.1.35504
Domain Number 1 Region: 40-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-39
Family SCAN domain 0.0000671
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 218-280
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-19
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 5 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 7 Region: 513-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000266
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000264
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007499163.1.35504
Sequence length 684
Comment PREDICTED: zinc finger protein 263 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MMTSAVACQASASLEQEGLLIVKLEEDCTWGQEISVQNPETNPETSHQCFRHFRYQQATG
PREAFIHLQELCHRWLRPEVHSKEQILDLLVLEQFLTILPGDIQTRVREQHPQNGEEAVT
LVEELQREHGRCRPQVTIHGRGQAVPLEETSPLGATQEPPNFKLEPSETEQSPCLGLQDL
LGPGPKGGPQPLKERASSTPWVSLLPSKAESTEDKETTGSQLPVTFEDVAVYLSQEEWGH
QEPSKKALSREVMQENYENVVSLESQIPSQDPASQIEQEEKPWDPNLQSAKEPGISKIPY
IEEKKENKEESSSEHFEEEQPQEIPSGHSEIEVPWSPEQGKSGQWNPSPEEKLGKPTAWA
LGRSDLIKPKKPQPGEKLYKCLVCEKNFSNNSNLIRHQRTHTTERLCMGLECGEIFGGNP
HFIPPHRVHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFSHSSNLIRHQRIHTGERPYKCSECGKGFSRSSHLVIHERT
HERERFYPFSECEGTVSNSTTFITNHGTQRGEKKLFKCLTCGKSFRQGMHLTRHQRIHTG
EKPYKCPLCGENFSHSSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSQCGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences F7B6R4
XP_007499163.1.35504 ENSMODP00000034671 ENSMODP00000034671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]