SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007499715.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007499715.1.35504
Domain Number 1 Region: 58-517
Classification Level Classification E-value
Superfamily Sema domain 3.53e-118
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1685-1812,2000-2186
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1150-1245
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000446
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 4 Region: 1242-1334
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000713
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 520-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000654
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1331-1376,1410-1463
Classification Level Classification E-value
Superfamily E set domains 0.0000000000271
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007499715.1.35504
Sequence length 2219
Comment PREDICTED: plexin-B1 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MCSFSSLGDLIHTGHAAVCLLCVLYQVTMLILGSALLQLLWAVCAPASTMQQTTLASFTP
NSTRLQHLVRDPTSGTLYLGATNFLFQLSSELKLEAAVSTGPVLDSRDCLPPVLPLECPQ
AQPTDNPNQLLLVSPGGPGRDEGALVVCGSAHQGVCEQRRLDHIGQLLLRPERPGDTQYV
AANDPAISTVGLVGQGPAGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEET
AKLAVGRLSEYSHHFVAAFARRTSVYFLFLRRDLQAQSRAFRPYLSRVCLSDQHYYSYVE
LPLSCGGTPYGLVQAAAVAVPGTGSQGDGGEVLFAAFSSVNPSATGRAPAAGASGASALC
AFPLDKVDQLANRTRDACYTRDGRAEDGTEIAYIEYDVNSNCAQLPVDTLDAYPCGSDHT
PSPMASRVPLEATPLVEWADVQLTAVAVSVEDGHTIAFLGDSQGQLHKVYLGPEGDHRPY
ATQLIQRDSAVSSDLIFDWALEHLYVMTQSTVVRVPVASCSQHLNCTSCLAPKDPYCGWC
VLLGRCSRRAECSRGRGPEPWLWSFSSEPKCLQIQDVSPANVSREEKRNIFLSISDLPVL
RPDESYSCYFEDYESPAVRTDAGVMCPSPDPSRTPALQMDADHVLVPLLLKFGDVVIAST
EFSFYDCAAVAMLHLSTPCQACVQSTWGCSWCVWQHLCTHKTTCEGGPIVHSQRPPLSAS
WPLLSSVAPTGDVHTFLPSVPPKSSVTPVPKLPPTEPGTPLVALSSPSTDIMPPPTEEAP
RTPPPELGIPLTVPMPTTIAPPTTEAFAFMPSTVGSKVTLSPALEIAPTEEPSHLPSISV
DSGSMEGVGDIVTLVDVPGAVTELEDLLPPAPSPSPLGDTAVLTSSSWDLGTLALSSSPH
WDQAPSAGPSTTFPGVAGSEEHAPDWLLTEDELPEADEWTGSDASPFSTSTLLSGDGDSS
EFEGPNAPHILLPDLDYQYDSPGLWELEEVINQGPAACPCVEGIEGSSLLPVQIGRELTL
LGRNFHLYQDGLGDYECVLELEGNMEVTEARVECDGVSGTLCRIICQLHQLSYEAPQPEF
HVPVFLRKSGRLRVDSAEGLHVTLYDCSVGRPDCSLCRTADPRYSCVWCDGEHPHCAARE
ACAETEAALCPAPLIHMVEPLTGPVDGGTRITIRGSNLGQKHQDIAETVTVAGVPCAVDA
QEYEVSSSIVCVTGGSGEEKVGHVTVEVPGGGHGISDHKFAYQDPEVRSIFPVRGPKAGG
TCLTLQGSKLLTGRLEDIRVLVGDHPCQLFSVAQMEQLQCQTSPSPVPAALQVAVWFGGV
GRQLQQGLFQYTPDPNITSAGPAKSFVSGGRVIWVHGQNLDVVQTPRIRVTVSTQEQHQR
QRRGLGRRRRIVPETVTECPPDVPCSTQHFEEPCHINSSHLLVCRTPAIPGLLGGTWVQL
EFVLDNLLFDFATLHPTRFSYEANPILKPLNMEDPSSPFRHKPGSVLSVEGENLDLAISK
EEVVAMIGDGPCLVKTLTRNHLYCEPPVEQPPPRHREGLNSLPEFTVQMGNLNFTLGRVQ
YDIESPLAFPVGAQVGLGVGASLLALGVLIIVFIYRRKSKQALRDYKKVQIQLENLETSV
RDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDYKSYAERVFFPGHRESPLHRDLGVPESRR
PTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDIL
RTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKH
QVDKGPVDSVTGKAKYTLNDNRLLREDLEYRPLTLNAVAVPGVGLAEAPGVPVKVLDCDT
ISQAKEKILDQLYKGAPLAQRPDPGALDVEWRSGVAGHLILSDEDVTSVVQGAWRRLNTL
QHYKVPDGATVALVPRFSKHIPRENQDYVPGEKTPMLEDMDEGGIRPWHLVKPSEEPEPP
RQRRGSLRGGDRERAKAIPEIYLTRLLSMKGTLQTFVDDLFQVILSTSRPVPLAIKYFFD
LLDDQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTF
MDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTISASDQEMNSALAELSR
NYSGDLSALVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences XP_007499715.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]