SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007499717.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007499717.2.35504
Domain Number 1 Region: 59-518
Classification Level Classification E-value
Superfamily Sema domain 2.88e-118
Family Sema domain 0.00012
Further Details:      
 
Domain Number 2 Region: 1151-1246
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000382
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 3 Region: 1243-1335
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000611
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 4 Region: 1686-1813
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000738
Family p120GAP domain-like 0.0098
Further Details:      
 
Domain Number 5 Region: 521-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000576
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1332-1377,1411-1464
Classification Level Classification E-value
Superfamily E set domains 0.0000000000228
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007499717.2.35504
Sequence length 1961
Comment PREDICTED: plexin-B1 isoform X4 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MPFVWESLGDLIHTGHAAVCLLCVLYQVTMLILGSALLQLLWAVCAPASTMQQTTLASFT
PNSTRLQHLVRDPTSGTLYLGATNFLFQLSSELKLEAAVSTGPVLDSRDCLPPVLPLECP
QAQPTDNPNQLLLVSPGGPGRDEGALVVCGSAHQGVCEQRRLDHIGQLLLRPERPGDTQY
VAANDPAISTVGLVGQGPAGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEE
TAKLAVGRLSEYSHHFVAAFARRTSVYFLFLRRDLQAQSRAFRPYLSRVCLSDQHYYSYV
ELPLSCGGTPYGLVQAAAVAVPGTGSQGDGGEVLFAAFSSVNPSATGRAPAAGASGASAL
CAFPLDKVDQLANRTRDACYTRDGRAEDGTEIAYIEYDVNSNCAQLPVDTLDAYPCGSDH
TPSPMASRVPLEATPLVEWADVQLTAVAVSVEDGHTIAFLGDSQGQLHKVYLGPEGDHRP
YATQLIQRDSAVSSDLIFDWALEHLYVMTQSTVVRVPVASCSQHLNCTSCLAPKDPYCGW
CVLLGRCSRRAECSRGRGPEPWLWSFSSEPKCLQIQDVSPANVSREEKRNIFLSISDLPV
LRPDESYSCYFEDYESPAVRTDAGVMCPSPDPSRTPALQMDADHVLVPLLLKFGDVVIAS
TEFSFYDCAAVAMLHLSTPCQACVQSTWGCSWCVWQHLCTHKTTCEGGPIVHSQRPPLSA
SWPLLSSVAPTGDVHTFLPSVPPKSSVTPVPKLPPTEPGTPLVALSSPSTDIMPPPTEEA
PRTPPPELGIPLTVPMPTTIAPPTTEAFAFMPSTVGSKVTLSPALEIAPTEEPSHLPSIS
VDSGSMEGVGDIVTLVDVPGAVTELEDLLPPAPSPSPLGDTAVLTSSSWDLGTLALSSSP
HWDQAPSAGPSTTFPGVAGSEEHAPDWLLTEDELPEADEWTGSDASPFSTSTLLSGDGDS
SEFEGPNAPHILLPDLDYQYDSPGLWELEEVINQGPAACPCVEGIEGSSLLPVQIGRELT
LLGRNFHLYQDGLGDYECVLELEGNMEVTEARVECDGVSGTLCRIICQLHQLSYEAPQPE
FHVPVFLRKSGRLRVDSAEGLHVTLYDCSVGRPDCSLCRTADPRYSCVWCDGEHPHCAAR
EACAETEAALCPAPLIHMVEPLTGPVDGGTRITIRGSNLGQKHQDIAETVTVAGVPCAVD
AQEYEVSSSIVCVTGGSGEEKVGHVTVEVPGGGHGISDHKFAYQDPEVRSIFPVRGPKAG
GTCLTLQGSKLLTGRLEDIRVLVGDHPCQLFSVAQMEQLQCQTSPSPVPAALQVAVWFGG
VGRQLQQGLFQYTPDPNITSAGPAKSFVSGGRVIWVHGQNLDVVQTPRIRVTVSTQEQHQ
RQRRGLGRRRRIVPETVTECPPDVPCSTQHFEEPCHINSSHLLVCRTPAIPGLLGGTWVQ
LEFVLDNLLFDFATLHPTRFSYEANPILKPLNMEDPSSPFRHKPGSVLSVEGENLDLAIS
KEEVVAMIGDGPCLVKTLTRNHLYCEPPVEQPPPRHREGLNSLPEFTVQMGNLNFTLGRV
QYDIESPLAFPVGAQVGLGVGASLLALGVLIIVFIYRRKSKQALRDYKKVQIQLENLETS
VRDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDYKSYAERVFFPGHRESPLHRDLGVPESR
RPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDI
LRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIK
HQVDKGPVDSVTGKAKYTLNDNRLLREDLEYRPLTLNAVAVPGVGLAEAPGVPVKVLDCD
TISQAKEKILDQLYKGAPLAQRPDPGALDVEWRSGVAGHLILSDEDVTSVVQGAWRRLNT
LQHYKVPDGATVALVPRFSKHIPRENQDYVPGERHAADIRG
Download sequence
Identical sequences XP_007499717.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]