SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007499815.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007499815.1.35504
Domain Number 1 Region: 689-951
Classification Level Classification E-value
Superfamily VPS9 domain 5.23e-41
Family VPS9 domain 0.0056
Further Details:      
 
Domain Number 2 Region: 438-565
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.97e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 364-453
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.05e-17
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.02
Further Details:      
 
Domain Number 4 Region: 9-214
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000213
Family DBL homology domain (DH-domain) 0.0098
Further Details:      
 
Domain Number 5 Region: 249-320
Classification Level Classification E-value
Superfamily PH domain-like 0.0000484
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007499815.1.35504
Sequence length 960
Comment PREDICTED: ALS2 C-terminal-like protein [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MCTPEETSLLQAEETFLALLGRINTLIFQPLLLAGEPSNSKDQECMRLLLQLSVQYQQLW
DLTQASLRTLRQRLNSPATVSMEALHLLHSPDLFLEAYRRYFVIYTSCVVVQTFQKATRK
KSEFWRSQRKALKQFLTNVTLETSGAAALPQVLCQPLTDHVQQYVLILLRLGDAVGEHHP
ARELAIQAADRFVTLQSFIRQALGEASATQGLWETLGNRLVDALCSADRRLLQDSQKVPV
VASPVRADRVLLFNDVLVLVQGHSFQTFDLKLVWVEARMNEKQISSGHGFHVITPEEEFC
LSAKDAQGQACWLSKVSQAICQALSGKKAMPGLEQDQNQEGIEPPAARYCLYTFQTVDRF
RLATYDGNWFWGKPHGKGTLKWPDGRNHVGDFHQGLEHGFGIRLVPHGAEDKYDCYKCHW
WEGQMQGYGICEYADESIYKGYFRDNLRQGFGVLESSPQAPQPFKFMGHWHRDKKNGYGV
WEDKDRGERYIGMWQADHRHGQGIVVTQSGICYQRTFHADKMVGPGILLLEDDSLYEGSF
TRDLAYIGKGKITFPNGYFLKASFSTGIGRGFHTQGVLETTAHPLDPMHTCKRQLGIDAF
PVESRWQGIYQQFQEFINSNCPEESQEVFLGFHIQTAKELRKSQEYLFCDRSNPDEVSAK
IKDILAELPTHQEPESLQLYLQKALKSSVHPLGKLLKLLTLAFQATYSGIGANKHLLVLA
QEEVKHHAKEIWAFYQGMLRVALKQQNLTREENEGNEKSHPEAYRLVLPLILPCFYPELF
MLYMLYHEKEDNLYSQGISDLSLFPDTKLLECLDVHKHLWPLKDLTLTTDQRHSLVRDRC
FLSATECLQKIITTVDPREKLEMLEKTYDEIEDTVSRVLEREYKLPMDDLLPLLIYVVSR
ARIQHLGAEIHLIRDMMDPIHRGGLYDFLLTALESCYEHIQKEDMRLHRLAGVRNQKALW
Download sequence
Identical sequences F6WPA3
ENSMODP00000017347 13616.ENSMODP00000017347 XP_007499815.1.35504 ENSMODP00000017347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]