SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007502084.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007502084.1.35504
Domain Number 1 Region: 27-236
Classification Level Classification E-value
Superfamily L domain-like 4.68e-43
Family Ngr ectodomain-like 0.0009
Further Details:      
 
Domain Number 2 Region: 1643-1733
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 2512-2610
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 2324-2416
Classification Level Classification E-value
Superfamily Immunoglobulin 7.8e-19
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 2127-2218
Classification Level Classification E-value
Superfamily Immunoglobulin 9.47e-19
Family I set domains 0.03
Further Details:      
 
Domain Number 6 Region: 1729-1830
Classification Level Classification E-value
Superfamily Immunoglobulin 3.32e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 7 Region: 1829-1926
Classification Level Classification E-value
Superfamily Immunoglobulin 7.71e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 8 Region: 2421-2518
Classification Level Classification E-value
Superfamily Immunoglobulin 9.73e-17
Family I set domains 0.008
Further Details:      
 
Domain Number 9 Region: 1942-2014
Classification Level Classification E-value
Superfamily Immunoglobulin 6.79e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 10 Region: 2238-2318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000446
Family I set domains 0.041
Further Details:      
 
Domain Number 11 Region: 2037-2126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000896
Family I set domains 0.037
Further Details:      
 
Domain Number 12 Region: 584-666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000348
Family I set domains 0.026
Further Details:      
 
Domain Number 13 Region: 484-569
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000118
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007502084.1.35504
Sequence length 2611
Comment PREDICTED: immunoglobulin superfamily member 10 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MKVKGKGLPHLLASLVSVCLATLPYGSACPRRCACYIPTEVHCTFRYLTAIPDSIPVNAE
RINLGYNSLTKLTETDFTGLHKLELLMLHSNEIRVISDKTFTDLYALQVLKMSYNKVRRL
HRDTFHGLRNLTRLHLDHNHLEFINPETFYGLTSLRLVHLEGNLLTQLHPNTFVSMSYLQ
IFKISFIKYIYLSDNFLTTIPQEMILYMTQLESIYLHGNPWVCDCELSWLPDWIQQHPDT
FKCKKERNASTFLQCPLCTNPKNYKGKRLAEISAEALSCMKPTIDSSLKIKNLTIPEEGD
SVTLLSKDFVAPLGLIVMNLTDQSGNEANLACSIQKPSKPLPISLAEESGYITLNTSFST
FLVCNIDHHHIQPLWRILAMYSDSPLRLERVLSLTQTPHLSQKYNQITARSEDIFTDIKA
ELRADPSWLMQDHISLQLDRTVTTLSTLHIQYLADAHVTVPREKGPIKHKWTMISRDNTT
KLERTVLVGGTTELDCPAQGDPSPRLEWVLADGSKVRAPYISEDGRILIDKAGKLELQTA
DGFDTGLYHCISTNYDDADILTYRVTVVDPNEGSYHVNGAPHMSSIGETLELPCQSAGIP
DASFSWVLPGNIVLHHSLGNKQILSDGTLRILKVTEQDSGYFRCVAANPYGVDFLNFQVL
VDTKGHIPEYQDGEAEGSGQEEPKTITTNPKEPPVVQNTVTPEADVTNPSKRKNYSELTY
RRHGEAISRRFREHRRQFPPSARRLDPRQWAAFLEKAKKLATPEKVGSAITTLPTQVTPL
SKLSADGEESSGILPPDEEFMLLTTRAMEISVSPVTTDPITPSSSSETSISPDMEAFPIV
SPQTLQHERPAKFISNTNLNLSTSIKTVPVSTQINLNTSGRMADIITRQLPTTSSLMPIT
VKILSEDQSLWERNEHSKSISTTSKDGVKDSNISISEDTDSKDLIFRDSINELSHQHMSV
ITENKSNNGNFYSQTTIKSHNSKFPTDSTILMQNPVWAIGDVTTTTPLMRHYGRRRKIWG
RRRIINPGRIPNTRGQRYPFLRPRFKFLPEERTTLLPKELDMKCPTCTPGMVLTTAPSHF
FLPSAVHDPLPKMNFAEVTLAPTTPYPHPASQLEEVDKPNVESEKTTPTIRYFSAESSHV
IPKNELVTLAPMPLDTEKTLPMSTSHPALFSTTPSASVTKKGAPIPTTRSSVIAISSAPS
VTAFTRAIRRKIPWHQIFVNKYVQTEVRKDFHKSSSQANTITVPPKMSPVVPIDGGSFHF
TTLLSKEMQIPTITQKLTSIPDGANPENLPTMTDLPSLAASTTTISTTVSFMSTHSPHIV
QPSTTVIRNRIARPGRRRGQRRRRPQKNIMTPRTITEVDNAITTSSVMTTTPSKMVVQPL
ISSSTFTVTLSPEGIKEIPTSNSFHPLTFNATGVNEVFKINSLVPSKTTEVNMTSSSKTL
QGTFTSKTPFLRISSGMEVPEVPSIPLTRSEVTDQVPITFLGTIAPNEPKPHEATSFHID
QHMSGPETEAPSRSYPQTESSFRTTPSIYADIYPTPALLLTTVEPQSSKDNVTPLWSENL
FWHQSYSEVAERGKIPGANVLTTINFPESITQHTPKWEDQQENVIKSSLDQIAVQETTTA
KHLTFGYLSRNRFEKPKIVGGKAASFTVLANSDAFLPCEATGNPLPTIHWTRVSSGIVLS
EETQESRFEVFSNGTLFIQNVNIQDRGQYLCVAANQHGSDRLHVTLSVIAYPPRILEGRT
KEITAHSGSSVEVKCRAEGRPTPKISWILANQTMVSESFQGNNQALVKPDGTLVINTLTV
YDRGIYTCMANNPAGMDSWLVKIQVIAAPPIILEQKRQFITGIWGENLKLPCTAQGNPQP
SVHWVLLDGTEVKPLQFINAKWFLFPNGTLYIRNIASSDRGNYECIATSSTGSERRVVNL
IIEERDTIPRIETASQKLTELNFGDKLLLNCSATGEPKPKIIWRLPSKAIVDQWHRMGSR
IHVYPNGSLLIEAVTEKDAGDYLCVARNKMGDDLILMKVSLRMKPAKIDHKQHFKKQVLY
GKDFQVDCKASGSPVPEISWSLPDGTMVNNVMQADDGRRRSRRYILFDNGTLYFNKVGIA
EEGDYTCYAQNTLGKDEMKVHLTVVTASPRIRQSHKTYVRVTAGETAILVCEVIGEPRPQ
IFWLLPSNDIISSSTDRYLLHDNGSLSISKVKLLDSGEYMCVARNPSGDDTRLYRLDVVS
KLPLINGLYSNKTVIRATAVRHSKKYLDCRAEGTPPPQIMWIMPDNIFLTAPYYGSRITV
HKNGTLEIRNVRLTDTADFICIVRNDGGESILVVQLKVLEMLRRPTFRNPFNEKIVAQPG
KPLALNCSVDGNPPPEIIWLLPNGTRFSGGTSNSRYQLGRNGSLIIMKPTRDDAGKYRCT
ARNQVGYIEKLIILEIGQKPVILTYVLGMIKGITGESVTLHCMSDGSPKPNIIWTVPSGH
VIDRPQMNGKYILHENGTLVIPKATPHDRGSYACKAQNTIGEAVITIPVMIVAYPPRITN
RPPRNVRTLTGAAIQLHCVALGIPKPEVTWEMPDHSVLSAAKKVRSTGSELLRPQGTLIL
QNPKTSDSGMYTCTAKNPLGSDYATTYVQVI
Download sequence
Identical sequences F7GEA8
XP_001370371.2.35504 XP_007502083.1.35504 XP_007502084.1.35504 XP_016280702.1.35504 XP_016280703.1.35504 13616.ENSMODP00000026602 ENSMODP00000026602 ENSMODP00000026602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]