SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007506839.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007506839.1.35504
Domain Number 1 Region: 128-222
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-22
Family I set domains 0.0023
Further Details:      
 
Domain Number 2 Region: 26-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000108
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007506839.1.35504
Sequence length 277
Comment PREDICTED: osteoclast-associated immunoglobulin-like receptor isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MVSTLCSLLCFGLYLSQRIQAQEGSLPKPILSAETDLIMTPGSNLSLKCKKPDSDHLMPQ
KWTYLLLKEGNSQPLQNHTATGSWAKFSLLLVTDQDSGNYSCKYLEFQNPQREPEASSAL
EIWVKDILQKLSLSALPQRIITPGENVTLLCHGPAWGMRFALYKEGDEKPMQIHDPIQDE
AEFLLTYVTTNHTGNYSCHHHSDAVNQVMAQPSDPLELIVKGELDIPLRQALGSTTILII
FSCAIILFFLFLLAFCYHRSYIASLADGISLNVCCSH
Download sequence
Identical sequences H9H7U9
XP_007506839.1.35504 ENSMODP00000026423 ENSMODP00000026423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]