SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007507635.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007507635.1.35504
Domain Number 1 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 48-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-24
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 282-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007507635.1.35504
Sequence length 351
Comment PREDICTED: zinc finger protein 184-like isoform X3 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MGARQVKRSCKEFLDKGRYCLLKPESGPLAPQLLKGSRRDPAVTESQEASMTFEDVAVYF
TWEEWRQLDFAQRALYRDVMLENYRNAVATGFKGPKPYLISQLERGEMLWILDLRETETT
EARRGTWPDGKTENKESGPKQGIPEDATSQGRLFREGQRENLNGNSARCQQENVVCGSRP
RETDPFREGGPFGDPQEKSYKCNQCKKAFRWKSMLILHHRIHSGEKPYVCNECEKAFSRS
SDLTNHKRIHRGEKPYECNVCGKSFTWSSNLINHKRIHSGERPYKCNICGKSFTQGSILI
KHHRVHSGEKPYECNECGKAFSQKGNLSNHQKIHTRKIIVVSPKKTNPENP
Download sequence
Identical sequences F7E6Y0
XP_007507634.1.35504 XP_007507635.1.35504 ENSMODP00000006505 ENSMODP00000006505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]