SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007507857.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007507857.1.35504
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 263-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 78-127
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000122
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007507857.1.35504
Sequence length 470
Comment PREDICTED: sushi repeat-containing protein SRPX2 isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MPIQLAPMRAPFLLIFLTKAVSPTWYAGSGYYPDESYNEVSVEMPPRAPSLDYRVPRWCY
TLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGYRLIGQRSVNCLPSRRWSGTAYCRQV
RCPVLPLITSGTYTCTNGILLDSRCDYNCASGYHLEGDRSRICMEDGRWSGGEPVCVDID
PPKIRCPHSREKMAEPEKLTARVYWDPPVVKDSADGTITRVTLRGPEPGSRFPEGEHVIR
YTAYDRAYNRASCKFIIKVQVRRCPTLKPPQHGYLTCTSAGDNYGAVCEYQCDGGYERQG
TPSRVCQSSRQWSGSQPICTPMKINVNVNSASALLDQFYEKRRLLIVSSPDPSNRYYKMQ
ISMLQQSTCGLDLRHMTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQHLTRSYFNMVL
IDKLGVDRERYMEPVTPEEIFTFIDDYLLSNQELDQRRKQQDLRSSEGRG
Download sequence
Identical sequences F7GLN8
XP_007507857.1.35504 ENSMODP00000014831 ENSMODP00000014831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]