SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007510784.1.44737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007510784.1.44737
Domain Number 1 Region: 61-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.48e-28
Family Glutathione peroxidase-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007510784.1.44737
Sequence length 191
Comment glutathione peroxidase [Bathycoccus prasinos]; AA=GCF_002220235.1; RF=representative genome; TAX=41875; STAX=41875; NAME=Bathycoccus prasinos; strain=RCC 1105; AL=Chromosome; RT=Major
Sequence
MLPLKAVTSPSVVLTSHTASKQLTKKRNIRMGGLFDMLTGKGGEGTPKVNASSIYELPNG
TDVDGNEFDYSSLKGKVVLITNGLVALEKKYKTEGLEILLFPSGQFGGQELANNADIKKF
AREKGFNGTVMAKGDVEGANATPMWSYCLDKFPGGVGWNFKAKFIVDREGNVVNRNSSSA
QDQEALIKPLL
Download sequence
Identical sequences K8EJE6
Bathy10g03880 XP_007510784.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]