SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007510855.1.44737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007510855.1.44737
Domain Number 1 Region: 80-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000132
Family Glutathione peroxidase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007510855.1.44737
Sequence length 239
Comment AhpC/TSA family protein [Bathycoccus prasinos]; AA=GCF_002220235.1; RF=representative genome; TAX=41875; STAX=41875; NAME=Bathycoccus prasinos; strain=RCC 1105; AL=Chromosome; RT=Major
Sequence
MYLRKITQFTTSSSAKLLFTSSSTTSALLLNNNIYKTKMMSTMTTTQTNFSSRRGAIFSL
KQQQQHKKRSFSLTTRAMGAKVGDQISGVLQVGPWIDGMPTPVNMAERCKGKKVILVGLP
VPGYIAGQDKLKGAGIDEVIIFCTNDTQVMDAWGEAQGIAGTNITFMGDPNSVMVENLGV
ELTHPGPCSKLGPGRSKRFAMYIDDGVIKTFNVAESPTDPAGDDFPEVACIDNMVDTMC
Download sequence
Identical sequences K8F9X4
XP_007510855.1.44737 Bathy10g04240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]