SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007511374.1.44737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007511374.1.44737
Domain Number 1 Region: 116-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.55e-22
Family PDI-like 0.013
Further Details:      
 
Domain Number 2 Region: 14-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000642
Family Thioltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007511374.1.44737
Sequence length 297
Comment predicted protein [Bathycoccus prasinos]; AA=GCF_002220235.1; RF=representative genome; TAX=41875; STAX=41875; NAME=Bathycoccus prasinos; strain=RCC 1105; AL=Chromosome; RT=Major
Sequence
MFGMKKSLTFVGLLAITGANAGAVDLTEGDFDAQVFESGKGAFVKFYAPWGGTNQRSRGV
TLQASRRRENWSIRSSLSKKKKSRRGEQRRACFCHFLVRRSFRILSYRYYLFIIIIIIIV
TNRCGHCKALKPAWDKLGDEYDGSSTVLIGDVDCTVHQNLCQKYGVQGYPTLKYFTANPM
GDAYNGGRDYEELSKFAKESLGPSCGVEHMDLCDAEQKKSLETKMALSDSELDKLIEDSD
AKLKQADEDLEALLKGLQQQYEDGKKAKEDAQAALSPELAQLRSVKRSRENGAKQEL
Download sequence
Identical sequences K8EYD3
Bathy08g02420 XP_007511374.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]