SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007512118.1.44737 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007512118.1.44737
Domain Number 1 Region: 51-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000471
Family PDI-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007512118.1.44737
Sequence length 191
Comment DSBA oxidoreductase [Bathycoccus prasinos]; AA=GCF_002220235.1; RF=representative genome; TAX=41875; STAX=41875; NAME=Bathycoccus prasinos; strain=RCC 1105; AL=Chromosome; RT=Major
Sequence
MTPEQLQYGVNKMQWYCEKFGGESRVMPMISRLSSVFESIGLPTYSLEGNTGPTLDGHRL
AHFMKEEYSQSHQDVFMDTIMIDYFCNSKAPCDETALLAACEKSFEANTSANAEEQKANL
ARAEEVLRDKSKYRDEVLAQVRDVQGRISGVPHFIIRNEDTKKKVEFSGAQPVETFLDAF
EELGGEGLELQ
Download sequence
Identical sequences K8FEF4
XP_007512118.1.44737 Bathy07g04790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]