SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007517198.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007517198.1.11023
Domain Number 1 Region: 70-569
Classification Level Classification E-value
Superfamily Sema domain 8.73e-92
Family Sema domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1430-1557,1723-1879
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.71e-33
Family p120GAP domain-like 0.029
Further Details:      
 
Domain Number 3 Region: 909-1000
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000153
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 4 Region: 1000-1089
Classification Level Classification E-value
Superfamily E set domains 0.0000000000014
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 5 Region: 572-624
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000235
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1088-1169
Classification Level Classification E-value
Superfamily E set domains 0.000000000306
Family Other IPT/TIG domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007517198.1.11023
Sequence length 1947
Comment PREDICTED: plexin-D1 [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MGAPLGDHLLLGPQPPPRDDMSPLCQELEQIRGEESPEGVSSWRDSELPGAEACLWPLLL
AGAAGALEVQRRFPSPTPTNNFALDGAAGTVYLAAVNRLYQLAAADLSLQAEAAVGPVAD
SPLCHAPQLPHAPCDHPRRPTDNHNKILQLDAAQGLLVVCGSAFQGVCELRRRGNISAQA
VRFPPAAPPAAPVAVFPSMLNVAANHPAASTVALLLPPAAGARGSRLLVGATYTGFGSAF
FPRNRSLEDHRFENTPEVAIRSLDARGDPARLFTFDLNPSDDNVLKVKAGAKERQRLGFV
RAFLRRPAGAGAGAAFAYLALTSEAAAGPGAGDKDKDGGARSLLARICLPRGDARKLTES
YVQLGLRCAGGAGRGDQFGRLVSVFPARRRLFGVFERPPAAPRPGPAPAALCAFRFADVQ
AAIRAARTACFVEPAPDVVAVLDSVVQGTGPACERKRNLQLQPEQLDCGAAHLQHPLSVL
QPLKATPIFRAPGLSSVAVASVGNYTVVFLGTVSGRLLKINLDENMQVVSRRAVTVALGE
PVHPIMEFDPSDPSLLYLMTTHQMARVSVAACSAHSTCGDCLGARDAYCGWCSLESRCTL
QQDCANASHPHFWASTSDGPARCPAMSVLPAEMDVRQEYPGLILQLAGSLPDLSGMDMAC
DFGRGVHTVARVPGPAFGHQMAYCSLLPRAQFPPFPDGQDHVTMQLTLQVNSQAVVDANF
TLYDCGRLPQVQPHAACTACLSAPWPCFWCSAQHVCVSNQSLCEASANPASPQDCAQTLP
LSLAPVPTGSSQSIPVPVANAAFFRGAALECSFGLENFEARWVNDSTVRCDHVVLHTTQK
SQVFALSLQLKGRPAHFLDSPDPVTVEVYSCAVGSPDCSQCLGREDLGHLCVWSDGCRPR
GMLQPQPGSCPAPEIRMIEPLSGPLDGGTLLTIRGRNLGRRLADVVHHVWVGGVACEPLA
DRYSVSEQIVCVTGPAPGPFSDVVTVNTSKEGKSRERFSYVLPLVHSLEPAMGPKAGGTR
LTVHGNHLHIGSELQVLLNHTEPCTELLRSETSVVCTVPEGALPAAVPVCIRLERRGCLR
ANLSFSYTRDPVITAISPRRSLVSGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLN
ATLLTCPSPGALSNASAQVDFFINGRAYLDEGFEAEEPLVPGETPRGSRFRLDYLPDPQF
STAKREKWIKHHPGEPLTLVIHKEQDGLGLQSHEYRVRIGQVACDIQIVSDRVIHCSINE
SLVAAEGQLPITVQVGNFNQTIATLQLGGSETAIVVSIVICSVLLLLSVVALFVFCTKSR
RAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRT
FFPTCSSLYEEQHVPPSQTPSSPGSTPAPKTHPLLGEWKVPESRRHMVEEGVGLFSSLLG
NKHFLVVFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKN
PKLMLRRTESVVEKMLTNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKAR
YTLNEEWLLRENVEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYS
QWPRAEDVDLEWFASTTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKK
DNALGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFL
DDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKN
PQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRRLVQRY
YQQIQAMTPLSEQEMNAHLAEESRKYQNEFNTNVAITEIYKYAKRYRPQIMAALEANPTA
RRTQLQQKLEQVLALMEDDIYQCYSEA
Download sequence
Identical sequences A0A1S2ZCD2
XP_007517198.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]