SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007522235.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007522235.1.11023
Domain Number 1 Region: 40-120
Classification Level Classification E-value
Superfamily HMG-box 1.2e-29
Family HMG-box 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007522235.1.11023
Sequence length 232
Comment PREDICTED: protein SOX-15 [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MALSGPTQDQAWSLDAPALMAPTSSSAFQEQEGTGSPVGSSGLPLEKVKRPMNAFMVWSS
AQRRQMAQQNPKMHNSEISKRLGAQWKLLGEEEKRPFVEEAKRLRARHLRDYPDYKYRPR
RKTKNSGTGPAHFGQGSSGVAGGRVWGPGYLTTQGSRGFGYQPPNYPTAYLPSSYSSRCK
PEGPSPSPSSFPQNNPRLQGELLPPYATYLPPSSPTPYNPPLSGGPMPLAHL
Download sequence
Identical sequences A0A1S2ZNS1
XP_007522235.1.11023 ENSEEUP00000012112 ENSEEUP00000012112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]