SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007524847.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007524847.1.11023
Domain Number 1 Region: 48-86
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000144
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007524847.1.11023
Sequence length 301
Comment PREDICTED: tubulin polyglutamylase complex subunit 1 [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MAALPAPLPSAKMAAVEKRRPAMVPAASFPDGGRPAVSRAAATAESEEDFLRQVGVTDML
RAALLKVLEARPEEPIAFLAHYFENMGLRSPASGGAGEPPGQLLLQQQRLGRALWHLRLA
HHSQRSAFNTNVGVAYECLSAGGRRKRPGLDGRTYSDLLRRICRDGEAPEEVVAPLLRRI
QCRDHEAVPLAVFRAGMLTCFVLLEFVARAGALYRLLEDPGLAVADRRVGQAVLDTLEGA
LQAGDGAPARYLEAGSRLGPDSLAQALDRALGARRPSHPMTREEFLQKAAALFIAKVKPV
G
Download sequence
Identical sequences A0A1S2ZUR6
XP_007524847.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]