SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007525743.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007525743.1.11023
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 5.89e-17
Family PX domain 0.005
Further Details:      
 
Domain Number 2 Region: 203-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000165
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007525743.1.11023
Sequence length 404
Comment PREDICTED: sorting nexin-5 [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MAAVPELLQEQEEDRSKMRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPIFQS
SEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFSGAKEVDDFFEQEKNFLINYYNRIKDSCGKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTAIKKYLLKVAELFEKLRKVESRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETNQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHAKNNVSLLQSCIDLFKNN
Download sequence
Identical sequences A0A1S2ZWM1
XP_007525743.1.11023 XP_016044935.1.11023 ENSEEUP00000006022 ENSEEUP00000006022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]