SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007525841.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007525841.1.11023
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.91e-48
Family Proteasome subunits 0.0000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007525841.1.11023
Sequence length 190
Comment PREDICTED: proteasome subunit alpha type-4 isoform X2 [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFG
VSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALA
LAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREK
KEKEQKEKDK
Download sequence
Identical sequences A0A1S2ZWV9 A0A2J8SKD0 F7HW08
ENSP00000402118 NP_001096138.1.87134 NP_001096138.1.92137 XP_001150431.1.37143 XP_004387520.1.4749 XP_005887680.1.15283 XP_005985058.1.78601 XP_007525841.1.11023 XP_008013908.1.81039 XP_008982475.1.60252 XP_009248351.1.23681 XP_011793803.1.43180 XP_011838107.1.47321 XP_011885245.1.92194 XP_012594868.1.48125 XP_017741258.1.44346 XP_017741259.1.44346 XP_018866374.1.27298 ENSMMUP00000033382 gi|156713444|ref|NP_001096138.1| ENSP00000402118 ENSCJAP00000043712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]