SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007539053.1.11023 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007539053.1.11023
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily EF-hand 1.02e-19
Family Calbindin D9K 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007539053.1.11023
Sequence length 79
Comment PREDICTED: protein S100-G [Erinaceus europaeus]; AA=GCF_000296755.1; RF=representative genome; TAX=9365; STAX=9365; NAME=Erinaceus europaeus; AL=Scaffold; RT=Major
Sequence
MCAKKSPAELKSIFEKYAAKEGDPDQLSKEELKLLIQTEFPNLLKGPSTLDDLFQELDKN
GDGEVSFEEFQVLVKKICQ
Download sequence
Identical sequences A0A1S3AQL7
XP_007539053.1.11023 ENSEEUP00000012567 ENSEEUP00000012567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]