SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007555041.1.10163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007555041.1.10163
Domain Number 1 Region: 546-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 2 Region: 99-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000305
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 46-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000458
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 500-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000461
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007555041.1.10163
Sequence length 591
Comment PREDICTED: complement component C8 alpha chain [Poecilia formosa]; AA=GCF_000485575.1; RF=representative genome; TAX=48698; STAX=48698; NAME=Poecilia formosa; AL=Scaffold; RT=Major
Sequence
MGTFNHVVVALCALYLFINPTVNATRKPWTTSQTRRIRAANSPAPIDCRVGRWSSWTRCD
SCTDKTLRFRHLEKPAQFGGTDCVGTLWDRLACPTATTQCMVKDYCGESFTCKETGRCIS
QSLRCNGEPDCDDFSDEDECDRITQREDKCSTLIPIPGAERGTQGYNLLTGDFMDQVLDP
KYFGGKCEYVYNGEWSKLMYDAFCESLQYNEDEKNYRKPYNYHTYSFVAEATSKGSDEYF
EDMQRLLEARQSMSSSNFGVSVGIAFVDIGVNKNAESEFLNNITKYQSQDFSFIRVWSKV
QTAHFKMRSNQLMLHEDFYIALMELPEQYDFGVYSRFLNTFGTHYVTEGTMGGSLEYVAV
LNKTAMAKSNIDAKRFQSCFGTSLGISYSFSEEAALGIKVKTSSCETNKEDFKANSSESA
VVEDIIKLVKGGITETGSGLLVIRDQDTYRKWGASLKYNPALTDFEILPIFEAVRLSTAA
DHAGARIDNLERAIEEYLREFDTCRCAPCRHNGIPVRSGTSCSCICKPGFRGVACEETLR
RDARTDGSWSCWGSWSSCSSGTKSRTRICNNPSPEGGGAPCLGSANQNRRC
Download sequence
Identical sequences A0A087Y2G6
XP_007555041.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]