SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007560548.1.10163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007560548.1.10163
Domain Number 1 Region: 82-224
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-39
Family Regulator of G-protein signaling, RGS 0.000000336
Further Details:      
 
Domain Number 2 Region: 769-850
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-26
Family DIX domain 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007560548.1.10163
Sequence length 850
Comment PREDICTED: axin-1 isoform X1 [Poecilia formosa]; AA=GCF_000485575.1; RF=representative genome; TAX=48698; STAX=48698; NAME=Poecilia formosa; AL=Scaffold; RT=Major
Sequence
MDAGTMSISDQRGFISDLGGSFTEDAPRPPVPGEEGELVCGDGRQHGNLTFSSKNEGAKS
EASVATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGILLFGKFLRQEDCADM
LDFWFACSGFRKLEASEGNEEKKVKLAKAIYKRYIQDNNGIVSRQIKPATKSFIRDCLMR
LHIDPAMFDQAQTEIQSRMEENTYPLFLKSDIYLEYTRTGGESPKLCSDRSSVSGNEKGL
SGYLPTLNEYEGPEETERDLTPSSQLTQKLLMETVPQQAASSAKFQDSQEYRPGACRESI
NPYYVNIGHVLAPATSANDSEQQSISSDAETLSLTDSSVNGVPPYRYRKQHRREMHESAK
ANGRVPLPHFPRTNRIPKDIHVEPERFAAELIKRLEGVLREREAEEKLEERLKRVRLEEE
GDEESSPSSLPSQRFPPSAYSLNYNPCYADITYSSPFVQDAHEENPESILDDHVQRVMKT
PVCESPGTGRHSPKSRSPDGFSGVRGVAQSGQGKHSARHGVKGETSHAYHHKYVPHSHTT
AVDPEGATRTHGNPAWNLETSYYGSKSRSYADGMTSNPVEHIGHSSKTGPQCKRAFKRGE
EARAYDAPRPVEEVEKKQKILLWLMEGQKEMAQQKRSPYGSVSGSKKTANHEGSRLGSSD
RSGSMHPCLGGQGRSSVQPFHPFIQDPTMPPNPAPSPLIQLEEVCRRLEEEKLKSGSLQP
KQRYVMEVIQRGRAAVRPAPVPLLNVVPAVSDSELSEPEHRATKKQPCENITVAYYFCEE
LIPYRTSVRGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEIREDDAVLPIFEE
KIIGKVEKVD
Download sequence
Identical sequences A0A087Y2D4
ENSPFOP00000012187 XP_007560548.1.10163 XP_016531016.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]