SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007571123.1.10163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007571123.1.10163
Domain Number 1 Region: 44-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000298
Family Growth factor receptor domain 0.005
Further Details:      
 
Domain Number 2 Region: 107-178
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000324
Family VWC domain 0.038
Further Details:      
 
Domain Number 3 Region: 212-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007571123.1.10163
Sequence length 367
Comment PREDICTED: protein NOV homolog [Poecilia formosa]; AA=GCF_000485575.1; RF=representative genome; TAX=48698; STAX=48698; NAME=Poecilia formosa; AL=Scaffold; RT=Major
Sequence
MDFFFTNIFNFVLHDKKMTNLSAVLVFFMTAQTFTVIGAQTCPRRCLCPAELPVCLPGVP
LVLDDCACCLVCAGQKGQACSEMKPCDTIKGLQCDYSVDVHKRTGICAVSVGNVCVLEGL
VYQHGQIFFPSCKYQCVCQNGQIACIPRCNLDVMLPGPDCPVPRKVQVPGECCEKWVCEP
QTEASALGGFAMAAFRQEETVGFGSWDPRLTCIEQTTEWGACSETCGMGVSTRVTNKNNH
CEMVKQSRLCMIRPCEDLQGQLTQVALMQRDRRCQRVVRSNKPVHLEHENCTSILAYKPR
YCGTCTDGRCCTPHKTKTTLVKFQCPDNRIRRRPVMAILTCVCHTHCPQDNVAWEPSLLL
YGGMTGR
Download sequence
Identical sequences A0A087XUU5
XP_007571123.1.10163 XP_014865627.1.96476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]