SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007575473.1.10163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007575473.1.10163
Domain Number 1 Region: 189-228
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007575473.1.10163
Sequence length 421
Comment PREDICTED: isthmin-2-like [Poecilia formosa]; AA=GCF_000485575.1; RF=representative genome; TAX=48698; STAX=48698; NAME=Poecilia formosa; AL=Scaffold; RT=Major
Sequence
MNPRDALRVCLLILAAESGCGLPTDRNTESSPQIRAEEQPDHPNLEHLQQENLLQTLPLP
PSSTSTQQQDLRSSPSPEGEEPGAFVLDLRKFPDLVNAYVGSQNPNIQVTIEVMEAAQTE
VEMDLAKENQRNDWSVSPSEWTSKKLFWPLFWESRLAGTGPEDYGYDPADALLGWSEEGE
TKYSFENEEWSDWAPCSTTCGPGSQKRTRSCGYGCTATESRTCDLESCSSAVVTETEATS
LHQFNNTDSSVDSCEKWLSCRNEFLQKYLHQVLTQLPSCPCSYPSEAVYGAISIPDRRLR
RTYRWRDASGPKERLDIYKPSARFCVRSMLSYDSLTLGAQHCCYDDRMRLITRGKGAGAP
DLIGAEFSPELHYQVDVLPWILCKGDWSRFHSARPPNNGLTCPENPAEPAFQTELREARE
Y
Download sequence
Identical sequences A0A087Y2R5
XP_007575473.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]