SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_007635640.1.28591 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007635640.1.28591
Domain Number 1 Region: 250-363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 458-575
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 661-698
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 371-408
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 417-456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 622-659
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007635640.1.28591
Sequence length 979
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X2 [Cricetulus griseus]; AA=GCF_000419365.1; RF=na; TAX=10029; STAX=10029; NAME=Cricetulus griseus; AL=Scaffold; RT=Major
Sequence
MGMDEVPGKDATLWALGIEPGSSWPLSCHPSSPPCRENHDERTDHHLSPGLTRARTPHTV
PVVIYDEPRQPGDSEPMAFVHFCRDEPPAGARPEERISVVLDLLAKGLSSKQEILGSNPS
GASAGCGRTLILLPRSASRGQHDRVALSLHNEWVVVPVRVCTQAGEHVCGGEARLGWWSL
LAQGVFGDLWHGLLTSWLRERETGPWDQEAGRALPKTPDAVPALTLGSKIQVNLFLTGRL
SSAVPALAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDV
EESHQCSLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFR
LSYIRGKLGQASCQTDEFRCDNGKCLPGPWQCNAVDECGDGSDEGNCSAPASEPPGSLCP
GGTFPCSGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGA
ARGPSDLHCTWLVDTQDTRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRP
VSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGGNGEGDDRSAGEQGCFS
EPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCF
SCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLV
IALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSA
TQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQT
VLGDGLLQAAPGAVPDAPAPHTDTGSPREAGDGPPPGGLGHVPEVGPSMPPPPLNLQDPE
YRPEDKERKVCEEEPREDSPAPVDTPPEPCLAQDPYPQTPAASSTQDPHSPEPLGVCRSP
PPTCSPILEASDDEALLVC
Download sequence
Identical sequences XP_007635640.1.28591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]