SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007640791.1.69978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007640791.1.69978
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.95e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007640791.1.69978
Sequence length 91
Comment PREDICTED: twist-related protein 1 [Cricetulus griseus]; AA=GCF_000223135.1; RF=representative genome; TAX=10029; STAX=10029; NAME=Cricetulus griseus; AL=Scaffold; RT=Major
Sequence
MANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSK
MASCSYVAHERLSYAFSVWRMEGAWSMSASH
Download sequence
Identical sequences A0A091D3L0 A0A1L1RNS3 A0A1V4KBQ3 G5BZJ0 L5KLN1 L9KFK0 S7N3A7
HGL_H00000242261-2 XP_003982906.2.62641 XP_005152920.1.78019 XP_005235694.1.75256 XP_005964434.1.78601 XP_006912033.1.64745 XP_007640791.1.69978 XP_008492413.1.100939 XP_008976967.1.60992 XP_010347649.1.74449 XP_010357004.1.97406 XP_010833891.1.44457 XP_010965478.1.22495 XP_011829290.1.47321 XP_012659810.1.62490 XP_012803049.1.11716 XP_016072556.1.3490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]