SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007663487.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007663487.1.37387
Domain Number 1 Region: 516-657
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.75e-62
Family A middle domain of Talin 1 0.000000801
Further Details:      
 
Domain Number 2 Region: 757-892
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.71e-53
Family I/LWEQ domain 0.00000217
Further Details:      
 
Domain Number 3 Region: 662-786
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.5e-52
Family I/LWEQ domain 0.0000047
Further Details:      
 
Domain Number 4 Region: 2246-2436
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.61e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1790-1924
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.76e-47
Family VBS domain 0.00000699
Further Details:      
 
Domain Number 6 Region: 1228-1364
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.1e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-32
Family Second domain of FERM 0.00000135
Further Details:      
 
Domain Number 8 Region: 1077-1210
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 4.39e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1472-1558
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000981
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 1956-2083
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000534
Family VBS domain 0.018
Further Details:      
 
Domain Number 12 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000398
Family Ubiquitin-related 0.07
Further Details:      
 
Domain Number 13 Region: 947-1046
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000247
Family I/LWEQ domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007663487.1.37387
Sequence length 2492
Comment PREDICTED: LOW QUALITY PROTEIN: talin-2 [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDDDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGAVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEIIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNIGSMPSPQQQVMV
GQMHRGHMPPLVRAQLCAFFSSPSSLTSIDSLECRRLYEFDNLPPLGQDMASRVWVQNKV
DESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAITTISSNLTEMSKGVKLLAA
LMDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGELLRQIG
ENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDSVLQNRVIAAATQCALSTSQL
VACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDTELLKQVSAAAGVVSQ
ALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDL
VNAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEG
LRVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPAAHQQLVQSCK
AVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVASAKAAVPTVSDQAAA
MQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAGDSQLK
PLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARG
VAASTNDPAAAHAMLDSARDVMEGSAMLIQEAKQALVAPGDAESQQRLAQVAKAVSHSLN
NCVNCLPGQKDVDVALKSIGESSKKLLVDSLPASTKPFQEAQSELNQAAADLNQSAGEVV
HATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLL
AAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGML
DNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLLAFGECVGIASKALCGLT
EAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATI
VAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNK
CRIATAPLIEAVENLTTFASNPEFVSIPAQISSEGSQAQEPILISAKTMLESSSFLIKTA
RSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQ
ASLAAVSQNLGTRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKEGGNPKA
QHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVDAIAEAMSKLDEGTPPEPKGT
FVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGRMAAATAEP
EEIGFQIKSRVQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARSVTEKVSLVLSALQ
AGNKGTQACITAASAVSGIIADLDTTIMFATAGTLNAENNESFADHRENILKTAKALVED
TKLLVSGAASTQDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAK
ALSDLIGATKGAASKPADDPSMYHLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEAT
IEYIKQELTVFQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSR
KAVSDMLTACKQASYHVEVSEDVRARALRYGNECTLGYLDLLEHVLVILQKPTPELKHQL
SALSKRVAGAVTELIQSAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPR
AKPKQADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAVDDGQW
SQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQD
SEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLK
KERELEEARKKLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences XP_007663487.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]