SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007669475.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007669475.1.37387
Domain Number 1 Region: 462-602
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  XP_007669475.1.37387
Domain Number - Region: 244-372
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 40-161
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000249
Family CRAL/TRIO domain 0.013
Further Details:      
 
Domain Number - Region: 376-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00352
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007669475.1.37387
Sequence length 696
Comment PREDICTED: SEC14 domain and spectrin repeat-containing protein 1 isoform X1 [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MEATIILPILKKKLAFLSGGKDRRSGLILTIPLCLEQTNMEELSVTLDYLLSIPSEKCKA
RGFTVIVDGRKSQWNVVKTVVLMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRL
GFEVILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRLVFEKFTKESTSLLDELALI
NNGSDKGNQQEKERSMDLNFLPSVDPETVLQTGHELLSELQQRRFNGSDGGVSWSPMDDE
LLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRTQW
GIGDSIRASQALQQKHEEIESQHSEWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLS
DVCYRQASQLEFRQNLLQAALEFHGVAQDLSQQLDGLLGMLCVDVAPADGASIQQTLKLL
EEKLKSVDIGLQGLREKGQSLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQ
RCEDMVDVRRLKMLQMVQLFKCEEDAAQAVEWLSELLDALLKTHIRLGDDAQETKVLLEK
HRKFVDVAQSTYDYGRQLLQATVVLCQSLRCTSRSSGDTLPRLNRVWKQFTIASEERVHR
LEMTIAFHSTAEKILQECPEQPEAIHDEEQFDEIEAVGKSLLDRLTVPVVYPDGNEQYFG
SPSDMASTAEHIRERMKLVSLKRQQLRQPEAASIDS
Download sequence
Identical sequences F6VRH2
ENSOANP00000013780 XP_001515483.1.37387 XP_007669475.1.37387 ENSOANP00000013780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]