SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007670230.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007670230.1.37387
Domain Number 1 Region: 12-195
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.53e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000493
Further Details:      
 
Domain Number 2 Region: 190-315
Classification Level Classification E-value
Superfamily E set domains 1.82e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007670230.1.37387
Sequence length 600
Comment PREDICTED: proto-oncogene c-Rel [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MISAQQPPGGRGPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDSNRTYPSIQIMNS
YGRGKGKVRITLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGQDRRALCFQNLGIRCVKKK
EVKEAIISRIATEINPFNVPEEQLLNIEDCDLNVVRLCFQVFLLDEHGNLTSALPPVVSN
PIYDNRAPNTAELRICRVNRNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGSFSQ
ADVHRQVAIVFRTPPYNKVITEPVTVKMQLRRPSDQEVSDPMDFRYLPDEKDPYGNKAKK
QRTPLTLQKLLHSYGPSISERPKACPPRPPGDLTGVRMIKKEPNLISQVAPLTEMHRTSS
GTTNQIASYYPPSISNPNTISHHASNIRPLIHGSSSNWSSLTLPVTPPNSFSSATLHPNS
QGHQSFPEMSNHLSSVGSNPCLYMDTNGTDGIGNLPIPQTDVFSASNSTMLPNHPMNSTA
PSNDGDMETDDLRFLSMNLEPQSYPMLSTKDYRRQMHQMPSTSVSTHGSCAAPFVSQSEA
FDSVNLSCLNSSILNESPASNHPNPNNHSYDQSNQYYVTDGLQSEDHYNSFEVNLDFFNS
Download sequence
Identical sequences F7DUB3
ENSOANP00000019630 ENSOANP00000019630 XP_007670230.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]