SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007670751.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007670751.1.37387
Domain Number 1 Region: 939-1066
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000916
Family GAF domain 0.02
Further Details:      
 
Domain Number 2 Region: 283-345,771-859
Classification Level Classification E-value
Superfamily EF-hand 0.0000262
Family Calbindin D9K 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007670751.1.37387
Sequence length 1362
Comment PREDICTED: EF-hand calcium-binding domain-containing protein 5 isoform X1 [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MASKSEQESQAKELTLPELGKAKNVAFSGEKPQETMRKDFPWKEIFTEKVEERSLALQQK
EVQKRNLQKTREEKMKKKVPIDALTKEWFNDENVTLDTRAYLLDKLLPTLVPGVEKLLME
VEKRKVLETDKIPPRFNSVNFLGEYLMRHNPEFHKVSEVSGYQRGMKEAMEEMKTQVPDT
PLNKIALMKEEVRKKRKWRDQVDEIKSKVKEKRKEALAVQFQEWILDVNGKIPLAIVQNA
LRSFLDTPVGNEAGSYAMALEIVDTLEQRLNEEEFLECVHSHIKDLSSDQFRELLKHFCQ
CTNDFRNVIRHDMWRQMFSDLFQACDTGKIGILDRQRTLSLLENFYDSSPAKARNRFRDP
RKWPVVELEEIEPAELWEDSEDEDSLSEEARGEFSVSQIQVALPAGQSDVALEDLQGSGA
EQGRSDQKSSSNSEASLTSITGDGQQEEVSLEEVTTPIKMSSSEKLSEPTGHLGSSLLGS
ETGSMASQGKSKPAAEQSQADPVEGRMEFQRRSCEGEEGPGGEEAAGEDATELEDASTGE
VVLGEEDVPRGEDTPGEEDAFGGEDDLGEEDDPGEEDAPGGKDSPGEEDATGGVDAPGGE
AEQGNQRMSPDPHQEVSMLQQEDETTGSSPGRISAANSFEGQAHTAKSFEATPQLIDEDL
WSGNLLTSDLSLKYINYGDHTQDALPFDDPRFSDLRLLMADIQAWGETRLRSPFSEKSLK
LPQFVQLLEMFVGEETSLATIKKLTEFFKAGYVETEDEKIEQLEKAHHEAFLARRKLLLR
ALFDKWDNESSGFLDLREVDAVLATFKEGMEKAALKKAKLHILLPKPHPGQEIRLSQKLF
QNYIEMIVAELPGNEDEVMDNMVEFLSASLERSHREQLRGSARRKWLHQVRHAAETSGMN
LEPVYKEIFKALAQDADIHGNKKISAHIALLEQNLLLPERGDVLLRNVACTLDDAPFVLN
KVLYRDMKGISFAVVDQGTPIHVPEVHYHGNVHFWHDSHPEEEQNGSLLVVPLQDSHRRA
FGVLAVDTLRTHYQAQSIFQTHEISFYQGVSRAFSITYHHVHAREHILHVVVTATDWLRN
RAPSIKSITTYLTEPTLGEISDYILRKIMMTDPTGQTEIHTSHAVLCRKENFFRDYLFKC
GDSSEVIVTLAFGEHHIAFPLRETSGRALWVFDINTGHSSLLPSKELRELQKMLKIVQAA
CYEILKEFSGETDKSYVLEIERAGEVKRAGILFYRFMLLELQACIQKLDPQASAQLKDYK
TPPRRMHNILRGVLLLLHPEWAESEELKSWDQCRQKVNGDLIRMVCSFDPTDSSVQVQPD
LIAKYVQGIHRRSVRRCGSILIEYLYNWTLTCLTLLELKKKL
Download sequence
Identical sequences F7BTH2
XP_007670750.1.37387 XP_007670751.1.37387 ENSOANP00000020017 ENSOANP00000020017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]