SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007684559.1.18027 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007684559.1.18027
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-44
Family GABARAP-like 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_007684559.1.18027
Sequence length 119
Comment hypothetical protein COCMIDRAFT_85944 [Bipolaris oryzae ATCC 44560]; AA=GCF_000523455.1; RF=representative genome; TAX=930090; STAX=101162; NAME=Bipolaris oryzae ATCC 44560; strain=ATCC 44560; AL=Scaffold; RT=Major
Sequence
MRSKFKDEHPFEKRKAEAERIRQKYNDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF
VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGEAL
Download sequence
Identical sequences E3RX05 M2S9R5 M2SQA5 N4X184 W6YSU5 W6ZZ07 W7EVT3
XP_003302160.1.2082 XP_007684559.1.18027 XP_007705035.1.66866 XP_007707196.1.9443 XP_014080593.1.79200 XP_014561898.1.39273 EFQ89746 jgi|Cocvi1|85461|e_gw1.3.95.1 jgi|CocheC5_1|25792|estExt_fgenesh1_kg.C_120034 jgi|Cocmi1|85944|e_gw1.18.149.1 jgi|Cocca1|32428|fgenesh1_pm.5_#_61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]