SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007707509.1.9443 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007707509.1.9443
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-48
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 369-545
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.79e-35
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000333
Further Details:      
 
Domain Number 3 Region: 283-361
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000155
Family Rhamnogalacturonase B, RhgB, middle domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007707509.1.9443
Sequence length 547
Comment polysaccharide lyase family 4 protein [Bipolaris zeicola 26-R-13]; AA=GCF_000523435.1; RF=representative genome; TAX=930089; STAX=5017; NAME=Bipolaris zeicola 26-R-13; strain=26-R-13; AL=Scaffold; RT=Major
Sequence
MRCLAALTTLLLAPTAVFAAWGWTDDGKNYVIDTNANLVVKVSKSNADMTSIKYRGVEYN
GQNGKNSHVESGLAPGTVTIKQYTSPANIIRVTMKVGTLTHTLVFRYGNPNVYIFMNKRD
TSITVSRYIVRIPANIFTNNVNEDTDWIPNGAPAIESGDINGVNGQTWSKHYSGKKYGRT
IDYDYVGYTNNNVGMYLIRSNHEKASGGPFFRSLIRRGGDGGPDLYDIYQYNMGHTDPMR
LGLQGPSVLHFTDNGAAPNHNLFARNANWDWFDSLEIEDWVPASRRGAVAGVGLANMKSG
FQYVVGLKNDQAQYWTIATGAWRISNALPGTYTLTVYKGELEVHTSTVTISPGSTATRNT
ITLVDPNDTPTIWRIGDWDGTPRGLLNFQDTPMKPTYMHPSDSRLAKWDAGNFIVGTTPI
SGFPAYIWKDINNDHLVYFRLTDAQLARGAKIRIGVTQGQAGGRPTVAVNAWVAKLPADK
GQGDTRSLTVGTYRGNNYVYEFEVPASAWVASAREYQILKITVISGKTAAGYLSPAVSFD
AVELIGL
Download sequence
Identical sequences W6YKH8
jgi|Cocca1|83548|e_gw1.7.68.1 XP_007707509.1.9443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]