SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007711761.1.9443 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007711761.1.9443
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.98e-22
Family Ubiquitin-related 0.00041
Further Details:      
 
Domain Number 2 Region: 257-318
Classification Level Classification E-value
Superfamily XPC-binding domain 5.36e-20
Family XPC-binding domain 0.00031
Further Details:      
 
Domain Number 3 Region: 309-376
Classification Level Classification E-value
Superfamily UBA-like 6.99e-16
Family UBA domain 0.001
Further Details:      
 
Domain Number 4 Region: 122-182
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000258
Family UBA domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007711761.1.9443
Sequence length 379
Comment hypothetical protein COCCADRAFT_36312 [Bipolaris zeicola 26-R-13]; AA=GCF_000523435.1; RF=representative genome; TAX=930089; STAX=5017; NAME=Bipolaris zeicola 26-R-13; strain=26-R-13; AL=Scaffold; RT=Major
Sequence
MKITFKDLKQNKFVIEAEPSETIGALKSKIQAEKGWEVPQQKLIYSGKILQDANTVESYN
IEEKGFIVCMVSKPKAAPAASSSKAAPSTPAPAPAQTPSAPQAPTQSSTTHNAPATPSPA
PAQASGERFNDPSALTMGGEREAAIANMESMGFARADIDRAMRAAFFNPDRAVEYLLTGI
PESALQEQAQQTQARAPNSPTPAGGNAGATAQANPSSGGDEPMNLFEAAAAAQNRGGAGG
ARSGGTGGAGAGALNANSLDFLRNNPQFQQLRQVVQQQPQMLEPILQQVGAGNPQLAQMI
ASNPEQFLQLLAEDADEDAPLPPGAQAISVTEEEREAIERLCRLGFERDLVIQAYFACDK
NEELAANFLFDQPDDADDQ
Download sequence
Identical sequences W6YR58 W7EDJ2
XP_007711761.1.9443 XP_014558112.1.39273 jgi|Cocca1|36312|fgenesh1_pm.63_#_26 jgi|Cocvi1|36518|fgenesh1_pm.29_#_59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]