SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007823989.1.8330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007823989.1.8330
Domain Number 1 Region: 347-459,519-542
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000662
Family Regulator of G-protein signaling, RGS 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007823989.1.8330
Sequence length 570
Comment Regulator of G protein signaling superfamily [Metarhizium robertsii ARSEF 23]; AA=GCF_000187425.2; RF=representative genome; TAX=655844; STAX=568076; NAME=Metarhizium robertsii ARSEF 23; strain=ARSEF 23; AL=Scaffold; RT=Major
Sequence
MGSEFGVTADSKKEANLDGVGIWWITWACVWTFVLLCGMGYLIHRRDTPILRIRGIGLSL
AAVVLLHLYFFSVQLGYVVGALAPGDCEYWIMGTYLPLGIAMFHASNSRFLYVAKVQKKY
LNRQVDGPAKSRRGMGILDRFRSLNYTTRMVILVSMGMGFQLFLTILMWLISRKWHSGWG
IPGTEVYGTEMEQRMEMGRGWEWWPGIFWQFVWAWIVAPCVLWQSRNINDTHGWRLQTIG
CAVAGLHATPMWLIALYVPAMEPVNKYFLPPQWICISILVLEILTVFLPCWEVVQASTLR
QETLDSIAQWERKNKNTGSSAKSVNTASTAIDSLMSGRKSTVGSVKSTDSQESILTMSAL
EYVLERNPTPLQEFSSLRDFSGENIAFLTSVAEWKTSLPQPVRDGVKDSTTRELIRERFN
SALRIYAEFISIKDAEFPINISSMELKRMEAVFEASARTLYGDKVEVDPATPFDFPEAAQ
KTSMETSSQASEKGRPAGTSYSDGVKFWGEIPESFDETVFDESEKHIKYLVLTNTWPKFV
KDRRVSIDMGASAERGPSIMSFVRSRRQKR
Download sequence
Identical sequences A0A0A1UQ20 E9F6A1
XP_007823989.1.8330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]