SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007888684.1.63211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007888684.1.63211
Domain Number 1 Region: 31-519
Classification Level Classification E-value
Superfamily Sema domain 1.01e-93
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 865-948
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000243
Family Other IPT/TIG domains 0.0072
Further Details:      
 
Domain Number 3 Region: 956-1047
Classification Level Classification E-value
Superfamily E set domains 0.000000000000131
Family Other IPT/TIG domains 0.071
Further Details:      
 
Domain Number 4 Region: 1389-1514
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000106
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 5 Region: 522-573
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000114
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1045-1121
Classification Level Classification E-value
Superfamily E set domains 0.00000000224
Family E-set domains of sugar-utilizing enzymes 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007888684.1.63211
Sequence length 1602
Comment PREDICTED: plexin-D1 isoform X2 [Callorhinchus milii]; AA=GCF_000165045.1; RF=representative genome; TAX=7868; STAX=7868; NAME=Callorhinchus milii; AL=Scaffold; RT=Major
Sequence
MQFLQRSLSLAVSWLLAMLYPGLPMELHQKYRTAQPTNNFAVDPVDGRVYLAAVNRLYQL
HWDLSEELRTITGPVEDNVLCHAPQLPEATCDRLKVMMDNHNKILQLDRGQDIIVVCGSV
YQGFCELRRVGNISEIAVEFPPHKSSDIVFPSMLYIAANDPNASTVGLILKTSRGGTKLL
VAATYTGLGTRFFPKNNSKEDLRFENTPEIAIRSLDISQLNRLFTYDINPSEDNVFKIKI
EAKARNRLSFVHAFIQKAYTYVAMNNDANSGNKESHPNSILARICLDNKSKSLSETKKLT
ESYIQVGLQCSVEERVFNRLVSVFPAQISLQAKPVPARAQPHTELQEVLFGVFERSDKHT
ALCVFSFSDIEQRIREARRNCFKEFKTEEVTVLDSVIQGSGPACKAKNITLQNTQLDCGA
AHLQHPLSIKTPIKATPIFVYTGLTSVAVLSVNNHTVVFLGTASGWMLKLNVRSNRTIGN
IKKIPVSPGESIHHIMQFDPQDSNYLYVMATYQMSRVKVATCDQYKSCTECLVAEDAHCG
WCTLESRCSLQKDCVDSNYPLYWTGLGSRLDQCPNMTIVPPEINLAHSNPSDIGITIGGN
VPDLSGRTVYCKYSNGEKTLVTVSKIKSYQLGYCPFLVKEKYPSFLPNKDHTVVIVEVQV
DNRTIVWGSLTIYDCERTGQVHAKTACASCLGTKWRCSWCVSDHKCVSSKDDCGDGLTAG
LATNLTQCPQIVAAAITLIPTGSEEVIPVTLVNSAGLQTTKLECDFGDQVLAATWLNTTT
VLCDAVKLSANNKSHGFPVNLRLRENPQKFIDNPNTISVEVYNCALGSTDCSQCWGREDQ
GHLCAWCESGLSCKLRSECRQVKETCAPPMITRIEPLTGPVDGGTLLTIKGSNLGRRFSD
IKEGVSIGEVQCIPLEKSYVVSEEIVCRTEPASSVLQGVVTVTVGKAGTSKEIFSFLVPE
VSSVSPDRGPKAGGTKVLISGQNLDIGSSIRVVVNGTQDCRDLIRTQNNITCVMPAFNRT
EVAVPVCVRFERKDCVHNSTTFQYMENPTIDSINPNTSYISGGRRITVKGHRFSLAQKVT
MVVQSLGKAESTCTVENDTVIICPSPAYSITKKGQPASVSFYINQIDYVDMEDSPGDNAA
HYKFTLDYRSDPHFSRKDKFIKHHQGEPLTLVIEKTADILNLAPEEYEVMVGPFLCEIYV
VKEKIHCTINVSLDTDERQLPVVVRVGRYNETIAMVQLGEIETFIVITIVVCIVLLLLCA
IALVVFCTKSRRAERYRQKTLLQMEEMEAQIRDEIRKGFAELQTDMTDLTKELNRSQGIP
FLEYKHFVIRTFFPKCSNEYENRIPQSLHQLSSPPNMTKMTAMPPESHPLLLNDWNIPEN
CRHNMEEGISMFSTLLNNKHFLVTFVHALEQQKDFAVRDRCKLASLLTIALHGKLEYYTS
IMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYRFLKETVGEPFFLLLCAM
KQQINKGSVDAITGKARYTLNEEWLLRENIEAKPTNLNVSFQGCGMDSLTVRVMDSDAIS
QNGLPPAPTAGYCGTWTTRHSMRTVGRNSTRFPITRSTMEHH
Download sequence
Identical sequences XP_007888684.1.63211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]