SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007935102.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007935102.1.48129
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000488
Further Details:      
 
Domain Number 2 Region: 244-350
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 3 Region: 127-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-36
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 4 Region: 362-470
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-33
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007935102.1.48129
Sequence length 812
Comment PREDICTED: deleted in malignant brain tumors 1 protein [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MVLRDSQNHSTPRPGSDSALALRLVNGGGQCQGRVEVLYRGSWGTVCDDSWDTNDANVVC
RQLGCGWAIAAPGNARFGQGSGPIILDDVRCSGQESYLWSCPHNGWLSHNCGHGEDAGVI
CSGPSSNCGGLLLNASGTFSSPSYPGFYPNNANCVWEIVVNSSSRINLGFNDLQLEMHNN
CMYDYVEIFDGPLNSSNLLGKLCNRTRQVFTSSSNRMTVRFRSDVSFQSTGFSAWFNSFP
SDARLRLVSSNYSHGRCAGRVEVYHSGRWGTVCDDSWDFQDAQVVCRQLGCGNAVSALGG
AYFGPGSGPITLDDVACSGTESTLWQCQNGGWFTHNCGHYEDAAVICSAPVYNSSRPTTN
YSCGGFLSQSSGQFSSPFYPENYPNNARCVWDIEVQNNYRVTVIFRDVQLEGGCRYDYIE
VFDGPYHSSPLIARVCDGSGSFTSSSNFMSVRFVSDGSVTRRGFRAEYYSSPSDDSTKLL
CLPSHMQASVSRSYLQSLGYSPQDLVIPGWTGRQCQPQITASQVIFTIPYSSCGTTKQVD
NDTISYSNFLKATTPSGIIKRKKDLHIHVICRMLKDTWVDTMYIANDTIEVKEIQYGNFD
VNISFYTSPSFSYPVTSSPYYVDLNQDLYLQAEIHHSDSSLALFVDTCVASPYPNDFTSL
TYDLIRSGCVKDETYRSYSQPAPGIARFRFSSFHFLNRFPSVYLQCQMVVCRAYDYSSRC
YRGCVVRSKRGVGAYQEKVDVILGPIRLQAPEKRSLDLSVAGGDKPVSSQGHYPSTAAIS
AGVFLVVVLVVAAFMLGRRARATGGRPLSYKM
Download sequence
Identical sequences XP_007935102.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]