SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007935394.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007935394.1.48129
Domain Number 1 Region: 244-499
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-63
Family Eukaryotic proteases 0.000000127
Further Details:      
 
Domain Number 2 Region: 64-178
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-24
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 204-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000165
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007935394.1.48129
Sequence length 503
Comment PREDICTED: complement C1r subcomponent-like protein [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MPPQKTGPPPSTRGYWPSTNPWWGNYLWKNPHPTSCPGKMWWLLLCGILQTCPTQGSVLL
AQRLPQKLTSPGYPKPYLKGQVSTTDIEAPEGFVVRLIFQDFDLEPSQDCEQDSVTVTGS
GTPPNRFCGQQGALLGSPPGQREFVSSGRSLQLTFRTDASSEDRIPHLHKGFLAFYQAMV
VDDSRPISQANGSSTAISTPGDNSSKTQSHCQELYYQAVPAGTLTCTIQGTWEDRQNREE
ASQCVPVCGRPVIPITENQEAFGSSRAQLGNFPWQAFTSIYGRGGGALLGDRWVLTAAHT
IYPKDSIFPQKNRSVNVFLGHTNIDEMLKLGNHHVRRVIVHPDYRQNESHNFNGDIALLE
LQHRVSLGPHLLPVCLPNNETLYLSGLWGYVSGFGMKMGWLTTELKYSRLPISKREDCEA
WLRERQRTEVFSDNMFCVGDKMQQQSVCQGDSGSIYVVWDDCAHQWVATGIVSWGIGCDK
GYGFYTKVLNYVDWIKRVMEGND
Download sequence
Identical sequences XP_007935394.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]