SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007953908.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007953908.1.48129
Domain Number 1 Region: 285-381
Classification Level Classification E-value
Superfamily Immunoglobulin 7.83e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 451-735
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000262
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 30-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000527
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 204-297
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000155
Family V set domains (antibody variable domain-like) 0.081
Further Details:      
 
Domain Number 5 Region: 130-202
Classification Level Classification E-value
Superfamily EF-hand 0.000000000461
Family Calmodulin-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007953908.1.48129
Sequence length 797
Comment PREDICTED: follistatin-related protein 5 [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MERGLLIQDGPFGSCENKYCGLGRQCVISRESGQAECACIELCKRHYKPVCGSDGQFYEN
HCEVHRAACLKKQKITIVHNEDCFFRGDNCKTAEYSKMKSILLNLQNQKYITQENENLKG
DDISRKKLLVDQMFKYFDADSNGLVEINELTQVIKQEEFSKDLSDCTLYDLLKYDDFNSD
KHLALEEFYRAFQVIQLSLPEDQKLSSIAVTVGQSAVLSCAIQGALRPPIIWKRNNIILN
NLDLEDINDFGDDGSLYITKVTTTHMGNYTCYAEGYEHVYQTHIFQVNVPPVIRVYPESQ
AREPGVTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGA
YTCIAKNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIEC
EFQRHIKPSEKLLGFQDEVCPKADGDEVQKCMWASAVNVKDKFIYVAQPTLDRILIVDVQ
SQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGTVEKTSPTLQVITLASGNVPHHTIHTQP
VGKQFDRVDDFFIATTTLIINHVRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCIPQ
SLAYTHLGGYYFIGCKPDSTGAIPPQLMVDGVTDSVIGFNSNVTGIPYVSPDGHYLVSIN
DVKGLVRVQYITIRGEIQEAFDIHTNLHISDVAFQPSFTEANQYNIYGSSSTQTDVLFVE
LASGKVKMIKSLKEPLKAEEWPWNQKNRKIQDSGLFGQYLMTPSKDSLFILDGRLNKLNC
EITEVEKGNTVIWVGDA
Download sequence
Identical sequences XP_007953908.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]