SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007954945.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007954945.1.48129
Domain Number 1 Region: 102-598
Classification Level Classification E-value
Superfamily Sema domain 7.06e-100
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1462-1587,1753-1909
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.3e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 939-1031
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000121
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 4 Region: 1030-1120
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000471
Family Other IPT/TIG domains 0.066
Further Details:      
 
Domain Number 5 Region: 1117-1198
Classification Level Classification E-value
Superfamily E set domains 0.000000000007
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 601-653
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000102
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_007954945.1.48129
Sequence length 1977
Comment PREDICTED: plexin-D1 [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MLCAATEAQPNAEAGSGHFGHNPPDQLTPWPTCTFEAKGEVCPDPANGQSSIKDFSAPAA
AANPLLLRPPFWPPPRPQVPPFCPLCLLLLLGAARAGALEIQRRFPSPTPTNNFALDGAA
GTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPRRLTDNYNKIL
QLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVHFPPAVPPAEPVTVFPSMLNVAANHPN
ASTVGLVLPPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEIAIRSLDARGD
LAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPQDPPPGAPSYAYLALNSEARAG
DKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSVFPARELL
FAVFERPPGTPAARTAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLDSVVQGTGP
ACERKRNIQLQPEQLDCGAAHLQHPLSVLQPLKATPVFRAPGLTAVAVASVNNYTVVFLG
TVIGRLLKINLNESMQVVSRRVVTVAYGEPVHHIMQFDPTDPGYLYLMTSHQMARVKVAA
CDVHSTCEDCVGAADAYCGWCTLETRCTLQQDCANSSQQHFWTSASEGTSRCPSMTVLPA
EIDVRQEYPGMILQLSGSLPDLSGMEMACDYESNVRTVARVPGPAFSHQIAYCNLLPKDQ
FPPFPQNQDHVNVEMSVRVNGRNIVRANFTIYDCSRIGQVYPHTACTSCLSTQWPCFWCT
QQHVCVSNQSRCEASPNLTSPQDCPQILPSSLAPVPTGGSQNILVPLANASFFQGTALEC
SFGPEEIFEAIWVNESTVRCNQVVLHTTQKSQVFPLSLQLKGQPTRFLDSLDPMTVEVYN
CAMGSPDCSQCLGREDLGHLCVWSDGCHLRESLKPLPGSCPAPEIHMIEPLSGPLDGGTL
LTIHGRNLGRRLKDVAHGVWIGGVACEPLADRYTVSEEIVCATGPAPGPFSDVVMVNASK
EGRSRERFSYVLPLVHSLEPAMGPKAGGTRITIHGSHLDVGSELQVLVNDTELCTDLVRA
ATSISCTVPGGALPIPVPVCVRFEHQGCTRGNLIFRYMQNPVITAISPRRSPVSGGRTIT
VAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFINGRVYAD
EAAVAEELLDPEEAQRGSRFHLDYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEQDSLGL
ESHEYRVKIGQVACDIQIVSDRVIHCSVNESLGATEGQLPITIQVGNFNQTIATLQLGGS
ETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAE
LQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYILPSQTLNSQGSSPVQE
THPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVLDRCSLASLL
TVALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRE
TVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMD
SLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYVLRDLDDTSV
VEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKK
SHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQA
EKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSI
SDLQLGKDSPTNKLLYAKEIPEYRKIVQHYYKQIHDMTPLSEQEMNAHLAEESRKYQNEF
NTNVAMAEIYKYAKRYRSQIMTALEANPAARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_007954945.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]