SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_007955389.1.48129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_007955389.1.48129
Domain Number 1 Region: 123-548
Classification Level Classification E-value
Superfamily Sema domain 6.41e-99
Family Sema domain 0.0003
Further Details:      
 
Domain Number 2 Region: 1450-1575,1769-1921
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.53e-39
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 909-1004
Classification Level Classification E-value
Superfamily E set domains 0.00000000000028
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 4 Region: 1001-1090
Classification Level Classification E-value
Superfamily E set domains 0.00000000000063
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 5 Region: 551-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000706
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1089-1133,1173-1226
Classification Level Classification E-value
Superfamily E set domains 0.000000127
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_007955389.1.48129
Sequence length 1988
Comment PREDICTED: plexin-B3 [Orycteropus afer afer]; AA=GCF_000298275.1; RF=representative genome; TAX=1230840; STAX=9818; NAME=Orycteropus afer afer; AL=Scaffold; RT=Major
Sequence
MLSEGVVLELGARSSAPKWKRAKAVPAWGREQAWTEAPIEARIDIAARHQGYHGQGWHFE
GLAPLAFLKGLCGPSRPLERDRRQAGFLAEGEGHAPMMAPWPPFCLHVLLLLLPTLPLTL
AHRFSAPNTTFNRLVLAPEPGSLYVGAVNRLFQLSPELQLEAMAVTGPVLDSPDCVPFRD
PAECPQAQLTDNANQLLLVSSRARELVACGQVRQGVCEKRRLGDVAELLYQAEDPGDGQF
VAANAPGVATVGLVVPMPGRDLLLVARGLAGKLSGGVPPLTVRQLAGPQPFSSEGLGRLV
VGDLSDYNNSYVGAFADARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLAC
RGQGLVQAAFLAPGALLGAFAGGPRGARAALCAFPLVQLDRSMEAARRLCYTAAGQGPSG
SEEATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRQAVEAQPLLLLGQPVSAITAL
QEDGHTVVFLGDTHGQLHKVFLNGSQGQVYDSQQVGPPGSAISPDLLVGGNGSHLYVLTA
QQVDRVPVATCPQFPDCTSCLQARDPLCGWCVLQGRCTRKGQCERAAQLNQWLWSYGEGD
CCPHIQALLPAQHPRQEQGQVTLSLPWLPALALDEYFHCAFGDYDSLAHVEGPHVTCVTP
PHDQVPPNPPGTDHVTLLLALMFEDVVVAAANFSFYDCSAIQALDVAAPCQACVGSLWQC
HWCPQSGQCVSGGHCPEGERIIYSAQEVDIQERGPEACPKVVGLAGPVLVPVGWESHLVL
RVRNLQHFRGLTASYNCWLELPGELRRLPASLEEVTADGSLIHCQSQQFHPSASQRELQV
PIYVTRGQAQRLDNADPLYVTLYDCAMGHPDCSRCQAANRSLGCLWCGHSQPACRYGPLC
PPGATQQLCPKPLIFSIEPHTGPPEGGLALTILGSDLGRDFADVWDAVSVAGRPCRPDPA
RYQISTRIICVTSPAPNGTTGPVQVAIKSRPPGISTQHFTYQDPILLSLSPRWGPQAGGT
QLTIRGRHLRTGGNVSAFVGGQPCPIQGPVCPEAITCRTMPQPALGKAAVRVVFGQAQRT
LPSSPFLYTANPQLLAAEPSVSFRGGGRLIRVRGSGLDVVQRPLLSVWLEAEGQAGDVPA
WPEPQPLEPRRSCGAPAADPQACVQLGGGLLQCSTACSVNSSSLLVCPSPAVPDGTRPHR
VFFTLDNLHVDFTRASGGQAFLYQPNPRLAPLSRESPTRPYRLKPGNVLDVEGEGLNLGI
SKEEVRVLIGDAECLVKTLTLTHLYCEPPPRAPRPHNGSGSLPQFVVHMGNVRLPLGPVQ
YEAEPALAAFPTEAQVGLGLGAVLLTGAVLVLTLKYRHKSRQALRDYRKVLLQLETLEIG
VGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYHTYAERVFFPGHGGCRLQPTPDGPEEG
GLSATVRQGLTQLSHLLNSKLFLLTLIRTLEEQPSFSQRDRCHVASLLSLALHSKLEYLT
DILWTLLGDLAAHYVAKNPKLMLRRTESMVEKLLTNWLSICLYSFLREVAGEPLYVLFRA
IKYQVDKGPVDAVTGKAKCTLNDSRLLREDVEFRPLTLMVLVGPGSGGVAGTGVEQWVPA
RVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGMAGHLTLSDEDLTSVTQSH
WKRLNTLQHYKVPDGATVGLIPHHTGAVAQSCPSGDNTPMLEAGEDDEEGRPRLWHLVKA
TEEPEGTKPRRSSLRERERERARAKAIPEIYLTRLLSMKGTLQKFVDDMFQAILSVNRPV
PIAVRYLFDFLDELAEKHGIQDPETLYIWKTNSLLLRFWVNTLKNPQLIFDVRVSDNVDA
VLAVLAQTFIDSCTLSEHKVGRDSPVNKLLYAREIPRYKQMVEKYYRDIRQSSPASYQDM
NSALAELSGRSASAPHCLEALRELYKHIHRYYDQIVSALEEDPVGQKMQLACRLQHIAAL
VENKVTHL
Download sequence
Identical sequences XP_007955389.1.48129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]